Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Clazakizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Clazakizumab ELISA Kit

Clazakizumab ELISA Kit

Product name Clazakizumab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX149
Note For research use only.
Sample type Plasma, Serum
Target Clazakizumab
Immunogen Clazakizumab

Introduction

The Clazakizumab ELISA Kit is a highly sensitive and specific tool used for the detection and quantification of the therapeutic antibody Clazakizumab. This kit is specifically designed for researchers and clinicians to study the structure, activity, and application of Clazakizumab, a promising therapeutic target for various inflammatory diseases.

Structure of Clazakizumab

Clazakizumab is a humanized monoclonal antibody that targets the pro-inflammatory cytokine interleukin-6 (IL-6). It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The antibody is produced through recombinant DNA technology, using Chinese hamster ovary (CHO) cells.

Mechanism of Action

Clazakizumab binds specifically to IL-6, preventing its interaction with its receptor and inhibiting downstream signaling pathways. This leads to a reduction in inflammation and its associated symptoms. IL-6 is known to play a crucial role in the pathogenesis of various inflammatory diseases, making Clazakizumab a promising therapeutic target.

Application of Clazakizumab ELISA Kit

The Clazakizumab ELISA Kit is a valuable tool for researchers and clinicians studying the efficacy and pharmacokinetics of Clazakizumab. It is particularly useful in clinical trials, where accurate quantification of the antibody is essential for determining its therapeutic potential.

The kit can also be used to monitor the levels of Clazakizumab in patient samples, providing valuable insights into its pharmacodynamics and potential side effects. This allows for personalized dosing and optimization of treatment regimens for individual patients.

Advantages of Clazakizumab ELISA Kit

The Clazakizumab ELISA Kit offers several advantages over other methods of detecting and quantifying the antibody. Its high sensitivity and specificity ensure accurate and reliable results, even at low concentrations. The kit also has a wide dynamic range, allowing for the detection of both high and low levels of Clazakizumab in various sample types.

Furthermore, the kit is user-friendly and can be easily performed in any laboratory setting. It provides results in a relatively short period, making it a time-efficient tool for researchers and clinicians.

Conclusion

The Clazakizumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Clazakizumab, a promising therapeutic antibody targeting IL-6. Its structure, mechanism of action, and application make it a valuable tool for researchers and clinicians studying the efficacy and pharmacokinetics of this antibody in various inflammatory diseases. With its numerous advantages, the Clazakizumab ELISA Kit is an essential tool in the development and optimization of Clazakizumab-based therapies.

Clazakizumab ELISA Kit

There are no reviews yet.

Be the first to review “Clazakizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products