Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Perakizumab Biosimilar – Anti-IL17A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $293.00.Current price is: $238.00.

100ug 19% OFF + 238 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade

Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1331830-76-2
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Perakizumab,RG4934,RO5310074,IL17A,anti-IL17A
Reference PX-TA1301
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1331830-76-2
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Perakizumab,RG4934,RO5310074,IL17A,anti-IL17A
Reference PX-TA1301
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1301-50
Uniprot ID Q16552
Source CAS 1331830-76-2
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Perakizumab,RG4934,RO5310074,IL17A,anti-IL17A
Reference PX-TA1301
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL17A[Homo sapiens] (Perakizumab) Monoclonal Antibody

Perakizumab is humanized monoclonal antibody that targets IL17A. It has an immunomodulator activity and is used in the treatment of arthritis.

SDS-PAGE for Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade

SDS-PAGE for Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade

Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Perakizumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Perakizumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products