Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bimekizumab Biosimilar – Anti-IL17A, IL17F mAb – Research Grade

  • PX-TA1342-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Product name Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1418205-77-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Bimekizumab,CDP4940,IL17A, IL17F,anti-IL17A, IL17F
Reference PX-TA1342
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1418205-77-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Bimekizumab,CDP4940,IL17A, IL17F,anti-IL17A, IL17F
Reference PX-TA1342
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1342-50
Uniprot ID Q16552 & Q96PD4
Source CAS 1418205-77-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Bimekizumab,CDP4940,IL17A, IL17F,anti-IL17A, IL17F
Reference PX-TA1342
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL17A[Homo sapiens] (Bimekizumab) Monoclonal Antibody

Bimekizumab has beeninvestigated for the treatment of Psoriatic arthritis, Ankylosing Spondylitis, Chronic Plaque Psoriasis, and Mild to Moderate Psoriasis.

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb (cat. No.PX-TA1342) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Flow Cytometry results for Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Flow Cytometry results for Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

There are no reviews yet.

Be the first to review “Bimekizumab Biosimilar – Anti-IL17A, IL17F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products