Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bimekizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Bimekizumab ELISA Kit

Bimekizumab ELISA Kit

Product name Bimekizumab ELISA Kit
Uniprot ID Q16552 & Q96PD4
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX258
Note For research use only.
Sample type Plasma, Serum
Target Bimekizumab
Immunogen Bimekizumab

Introduction

Bimekizumab is a novel monoclonal antibody that has shown promising results in treating various inflammatory conditions such as psoriasis and psoriatic arthritis. It works by targeting a specific protein in the body called interleukin-17 (IL-17), which is known to play a key role in the development of these diseases. The development of Bimekizumab has led to the creation of a specialized ELISA kit, which is used to measure the levels of this antibody in biological samples. In this article, we will explore the structure, activity, and application of the Bimekizumab ELISA Kit.

Structure of Bimekizumab ELISA Kit

The Bimekizumab ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) that is designed to detect and quantify Bimekizumab in various biological samples such as serum, plasma, and cell culture supernatants. The kit contains a pre-coated microplate, which is coated with a specific antibody that binds to Bimekizumab. The microplate also contains wells for the standards, controls, and samples to be added.

The kit also includes a detection antibody, which is labeled with an enzyme such as horseradish peroxidase (HRP). This detection antibody binds to a different site on the Bimekizumab molecule, forming a sandwich with the coated antibody. The kit also contains a substrate solution that produces a color change when acted upon by the enzyme, allowing for the quantification of Bimekizumab in the sample.

Activity of Bimekizumab ELISA Kit

The Bimekizumab ELISA Kit works on the principle of a sandwich ELISA, which is a widely used and highly sensitive method for detecting and quantifying specific proteins in biological samples. The kit is designed to specifically detect Bimekizumab and does not cross-react with other proteins or antibodies. It has a high sensitivity, with a lower limit of detection of 0.1 ng/mL, making it suitable for measuring low levels of Bimekizumab in biological samples.

The kit also has a wide dynamic range, with a standard curve that can detect Bimekizumab concentrations ranging from 0.156 ng/mL to 10 ng/mL. This allows for the accurate quantification of Bimekizumab in a variety of samples, including those with high or low levels of the antibody.

Application of Bimekizumab ELISA Kit

The Bimekizumab ELISA Kit has various applications in both research and clinical settings. In research, it can be used to measure the levels of Bimekizumab in cell culture supernatants, serum, and plasma samples. This allows for the evaluation of the pharmacokinetics of Bimekizumab, as well as its efficacy in treating different inflammatory conditions.

In clinical settings, the Bimekizumab ELISA Kit can be used to monitor the levels of Bimekizumab in patients receiving treatment for psoriasis and psoriatic arthritis. This can help clinicians determine the appropriate dosage and frequency of treatment, as well as assess the response to therapy.

Conclusion

The Bimekizumab ELISA Kit is a valuable tool for measuring the levels of Bimekizumab in various biological samples. Its high sensitivity and wide dynamic range make it suitable for both research and clinical applications. With the development of Bimekizumab and its specialized ELISA kit, there is hope for improved treatment options for patients with inflammatory conditions such as psoriasis and psoriatic arthritis.

Bimekizumab ELISA Kit

There are no reviews yet.

Be the first to review “Bimekizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products