Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Enokizumab Biosimilar – Anti-IL9 mAb – Research Grade

  • PX-TA1254-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $302.00.Current price is: $238.00.

100ug 21% OFF + 238 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade
Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade binds to Mouse IL9 Recombinant Protein, N-His in ELISA Assay
Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

Product name Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade
Uniprot ID P15248
Source CAS 909875-08-7
Species Humanized
Raw Antigen Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Enokizumab,7F3com-2H2,MEDI-528,IL9,anti-IL9
Reference PX-TA1254
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade
Uniprot ID P15248
Source CAS 909875-08-7
Species Humanized
Raw Antigen Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Enokizumab,7F3com-2H2,MEDI-528,IL9,anti-IL9
Reference PX-TA1254
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1254-50
Uniprot ID P15248
Source CAS 909875-08-7
Species Humanized
Raw Antigen Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Enokizumab,7F3com-2H2,MEDI-528,IL9,anti-IL9
Reference PX-TA1254
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL9[Homo sapiens] (Enokizumab) Monoclonal Antibody

Enokizumab has been investigated for the treatment of asthma.

SDS-PAGE for Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

SDS-PAGE for Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade binds to Mouse IL9 Recombinant Protein, N-His in ELISA Assay

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade binds to Mouse IL9 Recombinant Protein, N-His in ELISA Assay

Mouse IL9 Recombinant Protein, N-His(cat. No.ARO-P18500) at 0.5µg/mL (100µL/well) can bind Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

There are no reviews yet.

Be the first to review “Enokizumab Biosimilar – Anti-IL9 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products