Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Latikafusp Biosimilar – Anti-PDCD1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1 Lambda - Il21 fragment

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

Product name Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade
Uniprot ID Q9HBE5 & Q15116
Species Homo Sapiens Fusion
Raw Antigen Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Latikafusp,,PDCD1,anti-PDCD1
Reference PX-TA1856
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda - Il21 fragment
Clonality Monoclonal Antibody
Product name Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade
Uniprot ID Q9HBE5 & Q15116
Species Homo Sapiens Fusion
Raw Antigen Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Latikafusp,,PDCD1,anti-PDCD1
Reference PX-TA1856
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda - Il21 fragment
Clonality Monoclonal Antibody
Product name PX-TA1856-50
Uniprot ID Q9HBE5 & Q15116
Species Homo Sapiens Fusion
Raw Antigen Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Latikafusp,,PDCD1,anti-PDCD1
Reference PX-TA1856
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda - Il21 fragment
Clonality Monoclonal Antibody

Introduction

Latikafusp Biosimilar is a novel monoclonal antibody (mAb) that targets the programmed cell death 1 (PD-1) receptor, also known as the programmed death receptor-1 (PDCD1). This biosimilar is a research grade therapeutic agent that has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer. In this article, we will provide a scientific description of Latikafusp Biosimilar, including its structure, activity, and potential applications.

Structure of Latikafusp Biosimilar

Latikafusp Biosimilar is a recombinant humanized IgG4 monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CH) and one variable domain (VL). The variable domains of the heavy and light chains are responsible for the antigen-binding specificity of the antibody.

Activity of Latikafusp Biosimilar

Latikafusp Biosimilar binds to the PD-1 receptor, which is expressed on the surface of T cells, B cells, and natural killer (NK) cells. PD-1 is a negative regulator of T cell activation and plays a critical role in maintaining immune tolerance. When PD-1 binds to its ligands, PD-L1 and PD-L2, it inhibits T cell receptor signaling and suppresses T cell proliferation and cytokine production. This mechanism is exploited by cancer cells to evade immune surveillance and promote tumor growth. By blocking the interaction between PD-1 and its ligands, Latikafusp Biosimilar restores T cell function and enhances anti-tumor immune responses.

Application of Latikafusp Biosimilar

The primary application of Latikafusp Biosimilar is in the treatment of cancer. It has been shown to have potent anti-tumor activity in preclinical studies, and clinical trials are currently underway to evaluate its safety and efficacy in patients with various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. In addition to its anti-tumor activity, Latikafusp Biosimilar has also been shown to have immunomodulatory effects, which may have potential applications in the treatment of autoimmune diseases.

Mechanism of Action

The mechanism of action of Latikafusp Biosimilar involves binding to the PD-1 receptor and blocking its interaction with its ligands, PD-L1 and PD-L2. This leads to the activation of T cells and the enhancement of anti-tumor immune responses. In addition, Latikafusp Biosimilar has been shown to induce antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which may contribute to its anti-tumor activity.

Clinical Development

Latikafusp Biosimilar is currently in the clinical development stage, with several ongoing phase I and II clinical trials. These trials are evaluating the safety, tolerability, pharmacokinetics, and efficacy of Latikafusp Biosimilar in patients with advanced solid tumors. Preliminary results from these trials have shown promising anti-tumor activity, with manageable side effects.

Conclusion

In summary, Latikafusp Biosimilar is a novel monoclonal antibody that targets the PD-1 receptor and has potential applications in the treatment of cancer and autoimmune diseases. Its unique structure and mechanism of action make it a promising therapeutic agent, and ongoing clinical trials will provide more insights into its safety and efficacy. With further development, Latikafusp Biosimilar has the potential to become an important addition to the arsenal of cancer treatments.

SDS-PAGE for Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

SDS-PAGE for Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Latikafusp Biosimilar – Anti-PDCD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products