Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1302-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
[V-kappa]2-Fc

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Placulumab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Placulumab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 945781-29-3
Species Homo sapiens
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Placulumab,ART621,CEP-37247,PN0621,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1302
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [V-kappa]2-Fc
Clonality Monoclonal Antibody
Product name Placulumab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 945781-29-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Placulumab,ART621,CEP-37247,PN0621,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1302
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [V-kappa]2-Fc
Clonality Monoclonal Antibody
Product name PX-TA1302-50
Uniprot ID P01375
Source CAS 945781-29-3
Species Homo sapiens
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Placulumab,ART621,CEP-37247,PN0621,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1302
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [V-kappa]2-Fc
Clonality Monoclonal Antibody

General information on Anti-TNFSF2/TNF-alpha/TNFA[Homo sapiens] (Placulumab) Monoclonal Antibody

Placulumab has been investigated for the treatment of Rheumatoid Arthritis.

Placulumab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Placulumab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Placulumab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Placulumab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products