Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
VH-VH'-VH

Original price was: $324.00.Current price is: $238.00.

100ug 27% OFF + 238 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade
Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375 & P02768
Source CAS 1167985-17-2
Species Humanized
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ozoralizumab,ATN-103,ALB, TNFSF2, TNF-alpha, TNFA ,anti-ALB, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1272
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375 & P02768
Source CAS 1167985-17-2
Species Humanized
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ozoralizumab,ATN-103,ALB, TNFSF2, TNF-alpha, TNFA ,anti-ALB, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1272
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name PX-TA1272-50
Uniprot ID P01375 & P02768
Source CAS 1167985-17-2
Species Humanized
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ozoralizumab,ATN-103,ALB, TNFSF2, TNF-alpha, TNFA ,anti-ALB, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1272
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody

General information on Anti-ALB/TNFSF2/TNF-alpha/TNFA [Homo sapiens] (Ozoralizumab) Monoclonal Antibody

Ozoralizumab has been investigated for the treatment of Rheumatoid Arthritis.

SDS-PAGE for Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade

SDS-PAGE for Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade

Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products