Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sonelokimab Biosimilar – Anti-ALB,IL17A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
VH-VH'-VH

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade

Product name Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade
Uniprot ID Q16552 & Q96PD4 & P02768
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sonelokimab ,M-1095,MSB-0010841,ALB,IL17A,anti-ALB,IL17A
Reference PX-TA1606
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade
Uniprot ID Q16552 & Q96PD4 & P02768
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sonelokimab ,M-1095,MSB-0010841,ALB,IL17A,anti-ALB,IL17A
Reference PX-TA1606
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name PX-TA1606-50
Uniprot ID Q16552 & Q96PD4 & P02768
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sonelokimab ,M-1095,MSB-0010841,ALB,IL17A,anti-ALB,IL17A
Reference PX-TA1606
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody

Sonelokimab Biosimilar – A Novel Anti-ALB,IL17A mAb for Targeted Therapy

Sonelokimab Biosimilar, also known as Anti-ALB,IL17A mAb, is a novel monoclonal antibody (mAb) that has shown promising results in pre-clinical and clinical studies for the treatment of various inflammatory and autoimmune diseases. This biosimilar is a highly specific and potent inhibitor of interleukin-17A (IL-17A), a cytokine that plays a crucial role in the pathogenesis of several inflammatory conditions.

Structure of Sonelokimab Biosimilar

Sonelokimab Biosimilar is a humanized IgG1 monoclonal antibody that is produced using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the antibody are responsible for binding to the target molecule, IL-17A, while the constant region mediates effector functions such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

The unique structure of Sonelokimab Biosimilar allows it to specifically bind to IL-17A with high affinity and block its activity, thereby reducing inflammation and disease progression.

Mechanism of Action

Sonelokimab Biosimilar exerts its therapeutic effects by selectively targeting IL-17A, a pro-inflammatory cytokine that is known to play a central role in the pathogenesis of various autoimmune and inflammatory diseases. IL-17A is produced by a subset of T cells called Th17 cells and is involved in the recruitment and activation of immune cells, leading to tissue damage and inflammation.

By binding to IL-17A, Sonelokimab Biosimilar prevents its interaction with its receptor, IL-17RA, on the surface of target cells. This inhibits downstream signaling pathways and production of other pro-inflammatory cytokines, ultimately reducing inflammation and disease severity.

Therapeutic Applications

Sonelokimab Biosimilar has shown promising results in pre-clinical and clinical studies for the treatment of various inflammatory and autoimmune diseases, including psoriasis, psoriatic arthritis, ankylosing spondylitis, and rheumatoid arthritis. These conditions are characterized by increased levels of IL-17A and are often associated with significant morbidity and impaired quality of life.

In clinical trials, Sonelokimab Biosimilar has demonstrated significant efficacy in reducing disease activity and improving symptoms in patients with psoriasis and psoriatic arthritis. It has also shown promising results in patients with ankylosing spondylitis and rheumatoid arthritis, with a favorable safety profile.

Research Grade Sonelokimab Biosimilar

Sonelokimab Biosimilar is also available in a research grade format for use in laboratory studies and pre-clinical research. This research grade biosimilar is produced using the same manufacturing process as the clinical grade product, ensuring consistency and reliability in results.

The research grade Sonelokimab Biosimilar can be used to study the mechanism of action of IL-17A and evaluate the potential therapeutic benefits of targeting this cytokine in various disease models. It can also be used to screen for potential drug candidates and assess their efficacy in blocking IL-17A activity.

Conclusion

Sonelokimab Biosimilar is a novel and highly specific monoclonal antibody that targets IL-17A, a key cytokine involved in the pathogenesis of various inflammatory and autoimmune diseases. Its unique structure and mechanism of action make it a promising therapeutic option for patients with these conditions. With ongoing research and development, Sonelokimab Biosimilar has the potential to improve the lives of millions of patients worldwide.

SDS-PAGE for Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade

SDS-PAGE for Sonelokimab  Biosimilar - Anti-ALB,IL17A mAb - Research Grade

Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sonelokimab  Biosimilar - Anti-ALB,IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Sonelokimab Biosimilar – Anti-ALB,IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products