Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human Myoglobin recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P02144
Molecular weight:
18.06kDa

$250.00

50ug + 250 loyalty points
Full-length
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human Myoglobin recombinant protein

Human Myoglobin recombinant protein

Product name Human Myoglobin recombinant protein
Uniprot ID P02144
Uniprot link http://www.uniprot.org/uniprot/P02144
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGSHHHHHH
Molecular weight 18.06kDa
Purity estimated 70%
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms myoglobin, PVALB, MB, MGC13548
Reference PX-P4024
Note For research use only
Molecular Constructor
Full-length
Product name Human Myoglobin recombinant protein
Uniprot ID P02144
Uniprot link http://www.uniprot.org/uniprot/P02144
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGSHHHHHH
Molecular weight 18.06kDa
Purity estimated 70%
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms myoglobin, PVALB, MB, MGC13548
Reference PX-P4024
Note For research use only
Molecular Constructor
Full-length

There are no reviews yet.

Be the first to review “Human Myoglobin recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products