Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Aedes albopictus NIX, C-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Aedes albopictus
Uniprot ID:
A0A0G2UEH3
Molecular weight:
27.16 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Met1–Arg225 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Aedes albopictus NIX, C-His, recombinant protein

Aedes albopictus NIX, C-His, recombinant protein

Product name PX-P5452-100
Uniprot ID A0A0G2UEH3
Origin species Aedes albopictus
Expression system Prokaryotic expression
Raw Antigen Sequence MYSKSELNLINNQFEYIKKYCIYIGNIPAEVSKTDLIAKFSVFGEISNLYMKSFIQFCDVKPAVVRYRLMKSVKESSSLHNSRYIQSVLIVLPLDSSYNNYFLPYNTCVVVYTYNKFGMVDFYQKFSKLGDIHAMKKATNVMVYISFVSERAARTILDTKPTDIHINVQTINHVTRNINVCLIDFEKECTSNTAIKLTLLYNRSIGIFGLPSNFTEAKLHDEFSR
Molecular weight 27.16 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg225
Protein Accession A0A0G2UEH3
Reference PX-P5452
Note For research use only
Molecular Constructor
Met1–Arg225 His
Product name PX-P5452-1MG
Uniprot ID A0A0G2UEH3
Origin species Aedes albopictus
Expression system Prokaryotic expression
Raw Antigen Sequence MYSKSELNLINNQFEYIKKYCIYIGNIPAEVSKTDLIAKFSVFGEISNLYMKSFIQFCDVKPAVVRYRLMKSVKESSSLHNSRYIQSVLIVLPLDSSYNNYFLPYNTCVVVYTYNKFGMVDFYQKFSKLGDIHAMKKATNVMVYISFVSERAARTILDTKPTDIHINVQTINHVTRNINVCLIDFEKECTSNTAIKLTLLYNRSIGIFGLPSNFTEAKLHDEFSR
Molecular weight 27.16 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg225
Protein Accession A0A0G2UEH3
Reference PX-P5452
Note For research use only
Molecular Constructor
Met1–Arg225 His
Product name PX-P5452-50
Uniprot ID A0A0G2UEH3
Origin species Aedes albopictus
Expression system Prokaryotic expression
Raw Antigen Sequence MYSKSELNLINNQFEYIKKYCIYIGNIPAEVSKTDLIAKFSVFGEISNLYMKSFIQFCDVKPAVVRYRLMKSVKESSSLHNSRYIQSVLIVLPLDSSYNNYFLPYNTCVVVYTYNKFGMVDFYQKFSKLGDIHAMKKATNVMVYISFVSERAARTILDTKPTDIHINVQTINHVTRNINVCLIDFEKECTSNTAIKLTLLYNRSIGIFGLPSNFTEAKLHDEFSR
Molecular weight 27.16 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg225
Protein Accession A0A0G2UEH3
Reference PX-P5452
Note For research use only
Molecular Constructor
Met1–Arg225 His

Aedes albopictus NIX, C-His, recombinant protein

There are no reviews yet.

Be the first to review “Aedes albopictus NIX, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products