Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD79β/CD79B recombinant protein

  • PX-P6276
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P40259
Molecular weight:
24.04 kDa

$392.00

100ug + 392 loyalty points
His Asn37–Pro226
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD79β/CD79B recombinant protein

Product name Human CD79β/CD79B recombinant protein
Uniprot ID P40259
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHP
Molecular weight 24.04 kDa
Protein delivered with Tag? N-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Pro226
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference PX-P6276
Note For research use only
Molecular Constructor
His Asn37–Pro226

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Immobilized Human CD79β/CD79B recombinant protein (cat. No.PX-P6276) at 0.5µg/mL (100µL/well) can bind to Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb (cat. No.PX-TA1317) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human CD79β/CD79B recombinant protein

There are no reviews yet.

Be the first to review “Human CD79β/CD79B recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products