Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human BST2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q10589
Molecular weight:
39.49 kDa

$208.00

+ 208 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human BST2 Recombinant Protein

Human BST2 Recombinant Protein

Product name Human BST2 Recombinant Protein
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes
Product name Human BST2 Recombinant Protein
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes
Product name Human BST2 Recombinant Protein
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human BST2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products