Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ERBB4 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15303
Molecular weight:
30.59 kDa

$392.00

100ug + 392 loyalty points
His Cys29–Asn278
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ERBB4 recombinant protein

Product name Human ERBB4 recombinant protein
Uniprot ID Q15303
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence CAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHN
Molecular weight 30.59 kDa
Protein delivered with Tag? N-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys29-Asn278
Aliases /Synonyms HER4, Tyrosine kinase-type cell surface receptor HER4, p180erbB4, s80HER4, 4ICD, Receptor tyrosine-protein kinase erbB-4, Proto-oncogene-like protein c-ErbB-4, E4ICD
Reference PX-P6273
Note For research use only
Molecular Constructor
His Cys29–Asn278

Human ERBB4 recombinant protein

There are no reviews yet.

Be the first to review “Human ERBB4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products