Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alpha-1-acid glycoprotein 2(ORM2)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P19652
Molecular weight:
21.65 kDa

Original price was: $159.00.Current price is: $145.00.

100ug 9% OFF + 145 loyalty points
His Gln19–Ser201
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Alpha-1-acid glycoprotein 2(ORM2)

Product name Alpha-1-acid glycoprotein 2(ORM2)
Uniprot ID P19652
Uniprot link https://www.uniprot.org/uniprot/P19652
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQC FYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEA LDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES
Molecular weight 21.65 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Ser201
Protein Accession P19652
Spec:Entrez GeneID 5005
Spec:NCBI Gene Aliases AGP2; AGP-B; AGP-B'
NCBI Reference P19652
Aliases /Synonyms AGP 2,Orosomucoid-2,OMD 2,AGP2
Reference PX-P4780
Note For research use only
Molecular Constructor
His Gln19–Ser201
Product name Alpha-1-acid glycoprotein 2(ORM2)
Uniprot ID P19652
Uniprot link https://www.uniprot.org/uniprot/P19652
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQC FYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEA LDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES
Molecular weight 21.65 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Ser201
Protein Accession P19652
Spec:Entrez GeneID 5005
Spec:NCBI Gene Aliases AGP2; AGP-B; AGP-B'
NCBI Reference P19652
Aliases /Synonyms AGP 2,Orosomucoid-2,OMD 2,AGP2
Reference PX-P4780
Note For research use only
Molecular Constructor
His Gln19–Ser201
Product name PX-P4780-1MG
Uniprot ID P19652
Uniprot link https://www.uniprot.org/uniprot/P19652
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQC FYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEA LDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES
Molecular weight 21.65 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Ser201
Protein Accession P19652
Spec:Entrez GeneID 5005
Spec:NCBI Gene Aliases AGP2; AGP-B; AGP-B'
NCBI Reference P19652
Aliases /Synonyms AGP 2,Orosomucoid-2,OMD 2,AGP2
Reference PX-P4780
Note For research use only
Molecular Constructor
His Gln19–Ser201

Alpha-1-acid glycoprotein 2(ORM2)

There are no reviews yet.

Be the first to review “Alpha-1-acid glycoprotein 2(ORM2)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products