Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Leukotuximab Biosimilar – Anti-GPL115 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: $432.00.Current price is: $308.00.

50ug 29% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

Product name Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade
Uniprot ID P16150
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-GPL115, Leukocyte sialoglycoprotein, Leukosialin, Sialophorin, SPN, Galactoglycoprotein, CD43, CD43ct, CD43-ct, GALGP
Reference PX-TA2041
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade
Uniprot ID P16150
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-GPL115, Leukocyte sialoglycoprotein, Leukosialin, Sialophorin, SPN, Galactoglycoprotein, CD43, CD43ct, CD43-ct, GALGP
Reference PX-TA2041
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name PX-TA2041-50
Uniprot ID P16150
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GPL115, Leukocyte sialoglycoprotein, Leukosialin, Sialophorin, SPN, Galactoglycoprotein, CD43, CD43ct, CD43-ct, GALGP
Reference PX-TA2041
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody

Introduction

Leukotuximab Biosimilar is a research grade monoclonal antibody (mAb) that specifically targets the glycoprotein 115 (GPL115) antigen. This mAb is a biosimilar of Leukotuximab, a therapeutic antibody used in the treatment of various cancers. In this article, we will discuss the structure, activity, and potential applications of Leukotuximab Biosimilar as an anti-GPL115 mAb.

Structure of Leukotuximab Biosimilar

Leukotuximab Biosimilar is a recombinant, humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of the antibody is responsible for binding to the GPL115 antigen, while the constant region mediates effector functions such as complement-dependent cytotoxicity and antibody-dependent cellular cytotoxicity.

The amino acid sequence of Leukotuximab Biosimilar is highly similar to that of Leukotuximab, with only minor differences in the constant region. This allows for a similar binding affinity and specificity for the GPL115 antigen, making it a suitable biosimilar for research purposes.

Activity of Leukotuximab Biosimilar

The primary activity of Leukotuximab Biosimilar is its ability to bind to the GPL115 antigen. GPL115 is a glycoprotein that is overexpressed in various types of cancer cells, making it a promising therapeutic target. By binding to GPL115, Leukotuximab Biosimilar can inhibit its function and prevent cancer cell growth and proliferation.

In addition to its binding activity, Leukotuximab Biosimilar also has effector functions that can contribute to its anti-tumor activity. It can trigger complement-dependent cytotoxicity, where the antibody binds to the target cell and activates the complement system, leading to cell lysis. It can also induce antibody-dependent cellular cytotoxicity, where the antibody binds to the target cell and recruits immune cells to kill the cell.

Potential Applications of Leukotuximab Biosimilar

As a research grade antibody, Leukotuximab Biosimilar has potential applications in various fields of study. Its specific targeting of the GPL115 antigen makes it a valuable tool for studying the role of GPL115 in cancer development and progression. It can also be used in preclinical studies to evaluate the efficacy and safety of potential cancer treatments targeting GPL115.

Furthermore, Leukotuximab Biosimilar can be used in diagnostic assays to detect the presence of GPL115 in cancer cells. This can aid in early detection and monitoring of cancer progression, as well as in predicting response to treatment.

Conclusion

Leukotuximab Biosimilar is a research grade monoclonal antibody that specifically targets the GPL115 antigen. Its structure, activity, and potential applications make it a valuable tool for studying and understanding the role of GPL115 in cancer. With its potential to aid in the development of new cancer treatments and diagnostic methods, Leukotuximab Biosimilar holds promise in the fight against cancer.

SDS-PAGE for Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

SDS-PAGE for Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

SEC-HPLC of Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Leukotuximab Biosimilar - Anti-GPL115 mAb - Research Grade

There are no reviews yet.

Be the first to review “Leukotuximab Biosimilar – Anti-GPL115 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products