Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human BAFF – TNFSF13B – CD257 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9Y275
Molecular weight:
20.28kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human BAFF - TNFSF13B - CD257 recombinant protein

Human BAFF - TNFSF13B - CD257 recombinant protein

Product name Human BAFF - TNFSF13B - CD257 recombinant protein
Uniprot ID Q9Y275
Uniprot link http://www.uniprot.org/uniprot/Q9Y275
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MKHLWFFLLLVAAPRWVLSAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGSHHHHHH
Molecular weight 20.28kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms BLyS, TNFSF13B, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, CD257,BAFF, BLYS, TALL1, TNFSF20, ZTNF4
Reference PX-P4012
Note For research use only
Molecular Constructor
Partial Yes
Product name Human BAFF - TNFSF13B - CD257 recombinant protein
Uniprot ID Q9Y275
Uniprot link http://www.uniprot.org/uniprot/Q9Y275
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MKHLWFFLLLVAAPRWVLSAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGSHHHHHH
Molecular weight 20.28kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms BLyS, TNFSF13B, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, CD257,BAFF, BLYS, TALL1, TNFSF20, ZTNF4
Reference PX-P4012
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human BAFF – TNFSF13B – CD257 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products