Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD337 Recombinant Protein |
|---|---|
| Uniprot ID | O14931 |
| Uniprot link | http://www.uniprot.org/uniprot/O14931 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQL |
| Molecular weight | 20-25kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Leu134 |
| Aliases /Synonyms | 1C7,CD337,DAAP-90L16.3,LY117,MALS,NCR3,NKp30 |
| Reference | PX-P4120 |
| Note | For research use only |
The recombinant human CD337 / NKp30 / NCR3 protein is produced by a human cell expression system.
The protein is a natural cytotoxicity receptor (NCR), which helps NK cells to lyse tumor cells. The encoded protein interacts with the CD3-zeta T-cell receptor (CD247). The single nucleotide polymorphism in the 5 ‘untranslated region of the gene is associated with slight poverty. Three transcriptional variants of this gene encoding different isoforms have been found.
Send us a message from the form below
Reviews
There are no reviews yet.