Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Ciona intestinalis SLC Recombinant Protein |
---|---|
Uniprot ID | T2DR23 |
Uniprot link | http://www.uniprot.org/uniprot/T2DR23 |
Origin species | Ciona intestinalis |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLLDGRAPIKHVIIDMSACSFIDNDAVKTFSSIHDDLSKLGIKLLLADCRNYVRKCFQAGNFGLSEKEDSP EGATPTPVFFISVTAALTYARTDDVTSDDPITANDVDD |
Molecular weight | 12,97 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, imidazole 200mM if native conditions. PBS, imidazole 10mM, Urea 5M if denaturing conditions |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | AGV55623.1 |
Spec:SwissProtID | T2DR23 |
NCBI Reference | AGV55623.1 |
Aliases /Synonyms | SLC, sulfate transporter Ci-Slc26a alpha |
Reference | PX-P1150 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.