Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Ciona intestinalis SLC Recombinant Protein |
|---|---|
| Uniprot ID | T2DR23 |
| Uniprot link | http://www.uniprot.org/uniprot/T2DR23 |
| Origin species | Ciona intestinalis |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLLDGRAPIKHVIIDMSACSFIDNDAVKTFSSIHDDLSKLGIKLLLADCRNYVRKCFQAGNFGLSEKEDSP EGATPTPVFFISVTAALTYARTDDVTSDDPITANDVDD |
| Molecular weight | 12,97 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, imidazole 200mM if native conditions. PBS, imidazole 10mM, Urea 5M if denaturing conditions |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AGV55623.1 |
| Spec:SwissProtID | T2DR23 |
| NCBI Reference | AGV55623.1 |
| Aliases /Synonyms | SLC, sulfate transporter Ci-Slc26a alpha |
| Reference | PX-P1150 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.