Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Cow SAA3 Recombinant Protein |
---|---|
Uniprot ID | Q8SQ28 |
Uniprot link | http://www.uniprot.org/uniprot/Q8SQ28 |
Origin species | Cow |
Expression system | Prokaryotic expression |
Sequence | MRGSHHHHHHGSQRWGTFLKEAGQGAKDMWRAYQDMKEANYRGADKYFHARGNYDAARRGPGGAWAAKVISNARETIQGI TDPLFKGMTRDQVREDSKADQFANEWGRSGKDPNHFRPAGLPDKY |
Molecular weight | 14,19 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, imidazole 400mM, pH7.4 |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | NP_851359.2 |
Spec:Entrez GeneID | 281474 |
Spec:SwissProtID | Q8SQ28 |
NCBI Reference | NP_851359.2 |
Aliases /Synonyms | SAA3, serum amyloid A 3 precursor |
Reference | PX-P2056 |
Note | For research use only |
The Serum Amyloid A3 (SAA3) is a SAA isoform expressed in colostrum and milk of Bos Taurus (usual cows in Europe) and secreted in particular from uterine cervix cells and mammary gland. The SAA3 protein is a high-density lipoprotein particle (HDL).This type of proteins are usually product in the liver. SAA3 is an acute phase protein (APP) which is participating in the innate immune response. Serum Amyloid A are expressed in high concentrations during inflammation causing by viral or bacterial infections. These high expressions can be measured as a veterinarian diagnosis tool to identify intra-mammal infections in cows, as the level of SAA3 increases during inflammation processes. It is also expressed in variable levels during lactation period.
Several immunological functions of the SAA3 protein have been identified, such as opsonisation of bacteria, activation of metalloproteinase expression in immune cells, chemotaxis of immune cells, such as leukocytes, and cytokine modulation. In general, SAA3 protein is protecting organism as an anti-inflammatory factor.
The Cow SAA3 recombinant protein could be used for experiences of immunomodulation. Proteogenix offers this Cow SAA3 recombinant protein expressed in prokaryotic system to improve knowledge about immunity and inflammation mechanisms.
Send us a message from the form below
Reviews
There are no reviews yet.