Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | DNA topoisomerase 3-alpha (TOP3A) |
|---|---|
| Uniprot ID | Q9LVP1 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9LVP1 |
| Expression system | Eukaryotic expression |
| Sequence | MGASWSHPQFEKGGGSGGGSGGSAWSHPQFEKLEVLFQGESQTAGEVVRRCNLCNESDMALRKNRDGNFMVGCMNYPQCRNAVWLPGPTLEASVTTNVCQSCGPGPVYKILFKFRQIGIPPGFDVNHLGCVGGCDDILKQLIDICGTGSRSQARRTPGTAPSNNIQGSNTRQSNVCIHCQQRGHASTNCPSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEANRGRQFFSCPTQGCSFFAWEDSINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRRGSGTSFVSATGEPVSGIRCFSCGDPSHFANACPNRNNSNGNYF |
| Molecular weight | 35.29kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 50mM Tris-Cl pH 8.0, 150mM NaCl. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Fragment Type | Glu631-Phe926 |
| Aliases /Synonyms | / |
| Reference | PX-P4289 |
| Note | For research use only |
DNA topoisomerase 3-alpha is an enzyme encoded by the TOP3A gene in humans. This gene encodes DNA topoisomerase, an enzyme that controls and changes the topological state of DNA during transcription. This enzyme catalyzes the instantaneous breaking and agglomeration of single strands of DNA, which allows strands to cross each other, thereby reducing the number of supershells and altering the topological structure of DNA. The enzyme forms a complex with BLM, which can regulate the reorganization of somatic cells.
Send us a message from the form below
Reviews
There are no reviews yet.