Brand: ProteoGenix

DNA topoisomerase 3-alpha (TOP3A)

PX-P4289-100
Quality Chart

Host species:: Insect
Uniprot ID:: Q9LVP1
Molecular weight:: 35.29kDa

$500.00

100ug + 500 loyalty points

Glu631–Phe926

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

DNA topoisomerase 3-alpha (TOP3A)

Product name	DNA topoisomerase 3-alpha (TOP3A)
Uniprot ID	Q9LVP1
Uniprot link	https://www.uniprot.org/uniprot/Q9LVP1
Expression system	Eukaryotic expression
Sequence	MGASWSHPQFEKGGGSGGGSGGSAWSHPQFEKLEVLFQGESQTAGEVVRRCNLCNESDMALRKNRDGNFMVGCMNYPQCRNAVWLPGPTLEASVTTNVCQSCGPGPVYKILFKFRQIGIPPGFDVNHLGCVGGCDDILKQLIDICGTGSRSQARRTPGTAPSNNIQGSNTRQSNVCIHCQQRGHASTNCPSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEANRGRQFFSCPTQGCSFFAWEDSINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRRGSGTSFVSATGEPVSGIRCFSCGDPSHFANACPNRNNSNGNYF
Molecular weight	35.29kDa
Purity estimated	>90% by SDS-PAGE
Buffer	50mM Tris-Cl pH 8.0, 150mM NaCl.
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Fragment Type	Glu631-Phe926
Aliases /Synonyms	/
Reference	PX-P4289
Note	For research use only
Molecular Constructor	Glu631–Phe926

General information on DNA topoisomerase 3-alpha (TOP3A):

DNA topoisomerase 3-alpha is an enzyme encoded by the TOP3A gene in humans. This gene encodes DNA topoisomerase, an enzyme that controls and changes the topological state of DNA during transcription. This enzyme catalyzes the instantaneous breaking and agglomeration of single strands of DNA, which allows strands to cross each other, thereby reducing the number of supershells and altering the topological structure of DNA. The enzyme forms a complex with BLM, which can regulate the reorganization of somatic cells.

There are no reviews yet.

Be the first to review “DNA topoisomerase 3-alpha (TOP3A)”

DNA topoisomerase 3-alpha (TOP3A)

DNA topoisomerase 3-alpha (TOP3A)

General information on DNA topoisomerase 3-alpha (TOP3A):

Recently viewed products

Can’t find what you need?

Cart (0 Items)

DNA topoisomerase 3-alpha (TOP3A)

Specifications DNA topoisomerase 3-alpha (TOP3A)

Description

General information on DNA topoisomerase 3-alpha (TOP3A):

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

DNA topoisomerase 3-alpha (TOP3A)