Skip to main content
Contact +1 (919) 234-1277

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Drosophila RBf1 Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Tags:
Specification
Description
Documents
Publications
Reviews
Product nameDrosophila RBf1 Recombinant Protein
Uniprot IDQ24472
Uniprot linkhttp://www.uniprot.org/uniprot/Q24472
Origin speciesDrosophila
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTELDFRHNP HCILSNFCDMTEEAKAMKATTFRQIMSSFFQASTIYGNKDTMLGLLANENFERNLKSLNISYEQYVLSVGEFDERILSAY DAGEHTALNDQSLRPPVTPLTRKQDLPAQPAMAGDKFEPVRNATNNVKQLSAFGRITEPTDFVKQAGEEVIAKLLSIIEE IEQKFLAKYPSTEAKSRFQLAKSFFFYLLDQILQAEIRNKPDIDLKRLLVQKVSLVIFNITLMACCVELVLEAYKTELKF PWVLDCFSISAFEFQKIIEIVVRHGSHEGCLNRSLIKHLNSIEETCLERLAWARNSTVWEMIASAQLPLPTWLMVNLDRA AGPLQIFLRKVYLLGWLRIQKLCSELSLCEKTPESIWHIFEHSITHETELMKDRHLDQNIMCAIYIYIRVKRMEDPKFSD IMRAYRNQPQAVNSVYREVFIDINEDGEPKVKDIIHFYNHTYVPLMRQFVIDYLNVTPDVSGRASDLQLSPHPKERAAQP KKVTQSHSLFVSQMSKNEIQQSPNQMVYSFCRSPAKDLQAMNEKVRGGKRMLSFGDEPGLGTMAETKRSKISQVKAVMDD PELQSAEQQTAVTTEGCVGGEGGEHET
Molecular weight94,87 kDa
Purity estimated80%
BufferTrisHC 50mMl, 10mM glutathione reduced pH8
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionNP_525036.2
Spec:Entrez GeneID31027
Spec:NCBI Gene AliasesRBF1, Rbf1, rb, pRb, rbf, dRBF, RB, Rb1, DmelCG7413, EG:34F3.3, Rb, RBF, RbF, rbf1, CG7413, FBF
Spec:SwissProtIDQ24472
NCBI ReferenceNP_525036.2
Aliases /SynonymsRBf1, Retinoblastoma-family protein, CG7413, rb, pRb, rbf, dRBF, RB, Rb1, DmelCG7413, EG:34F3.3, Rb, RBF, RbF, rbf1, CG7413, FBF
ReferencePX-P1145
NoteFor research use only

Description of Drosophila RBf1 Recombinant Protein

General information on Drosophila RBf1 Recombinant Protein

The retinoblastoma protein (pRb) is a tumor suppressor protein that is dysfunctional in a lot of cancers. Retinoblastoma family protein (Rbf) from Drosophila melanogaster (Fruit fly) plays an important role in cell cycle regulation. It is also a component of the DREAM complex, a multi-protein complex that can act as a transcription activator or repressor. In follicle cells, the complex may have a main role in the site-specific DNA replication at the chorion loci. During development, the complex represses transcription of developmentally controlled E2F target genes.

Datasheet Download
MSDS Download

Publication

  • 1: Nicolay BN, Gameiro PA, Tschöp K, Korenjak M, Heilmann AM, Asara JM,_x000D_ Stephanopoulos G, Iliopoulos O, Dyson NJ. Loss of RBF1 changes glutamine_x000D_ catabolism. Genes Dev. 2013 Jan 15;27(2):182-96. doi: 10.1101/gad.206227.112._x000D_ Epub 2013 Jan 15. PubMed PMID: 23322302; PubMed Central PMCID: PMC3566311.
    • _x000D_ _x000D_ _x000D_
  • 2: Raj N, Zhang L, Wei Y, Arnosti DN, Henry RW. Ubiquitination of retinoblastoma _x000D_ family protein 1 potentiates gene-specific repression function. J Biol Chem. 2012_x000D_ Dec 7;287(50):41835-43. doi: 10.1074/jbc.M112.422428. Epub 2012 Oct 18. PubMed_x000D_ PMID: 23086928; PubMed Central PMCID: PMC3516731.
    • _x000D_ _x000D_ _x000D_
  • 3: Keller SA, Ullah Z, Buckley MS, Henry RW, Arnosti DN. Distinct developmental_x000D_ expression of Drosophila retinoblastoma factors. Gene Expr Patterns. 2005_x000D_ Feb;5(3):411-21. PubMed PMID: 15661648.
    • _x000D_ _x000D_ _x000D_
  • 4: Clavier A, Rincheval-Arnold A, Baillet A, Mignotte B, Guénal I. Two different _x000D_ specific JNK activators are required to trigger apoptosis or compensatory_x000D_ proliferation in response to Rbf1 in Drosophila. Cell Cycle. 2016;15(2):283-94._x000D_ doi: 10.1080/15384101.2015.1100776. PubMed PMID: 26825229; PubMed Central PMCID: _x000D_ PMC4825841.
    • _x000D_ _x000D_ _x000D_
  • 5: Ran X, Bian X, Ji Y, Yan X, Yang F, Li F. White spot syndrome virus IE1 and_x000D_ WSV056 modulate the G1/S transition by binding to the host retinoblastoma_x000D_ protein. J Virol. 2013 Dec;87(23):12576-82. doi: 10.1128/JVI.01551-13. Epub 2013 _x000D_ Sep 11. PubMed PMID: 24027329; PubMed Central PMCID: PMC3838160.
    • _x000D_ _x000D_ _x000D_
  • 6: Edgar KA, Belvin M, Parks AL, Whittaker K, Mahoney MB, Nicoll M, Park CC,_x000D_ Winter CG, Chen F, Lickteig K, Ahmad F, Esengil H, Lorenzi MV, Norton A, Rupnow_x000D_ BA, Shayesteh L, Tabios M, Young LM, Carroll PM, Kopczynski C, Plowman GD,_x000D_ Friedman LS, Francis-Lang HL. Synthetic lethality of retinoblastoma mutant cells _x000D_ in the Drosophila eye by mutation of a novel peptidyl prolyl isomerase gene._x000D_ Genetics. 2005 May;170(1):161-71. Epub 2005 Mar 2. PubMed PMID: 15744054; PubMed _x000D_ Central PMCID: PMC1449713.
    • _x000D_ _x000D_ _x000D_
  • 7: Milet C, Rincheval-Arnold A, Moriéras A, Clavier A, Garrigue A, Mignotte B,_x000D_ Guénal I. Mutating RBF can enhance its pro-apoptotic activity and uncovers a new _x000D_ role in tissue homeostasis. PLoS One. 2014 Aug 4;9(8):e102902. doi:_x000D_ 10.1371/journal.pone.0102902. eCollection 2014. PubMed PMID: 25089524; PubMed_x000D_ Central PMCID: PMC4121136.
    • _x000D_ _x000D_ _x000D_
  • 8: Krivy K, Bradley-Gill MR, Moon NS. Capicua regulates proliferation and_x000D_ survival of RB-deficient cells in Drosophila. Biol Open. 2013 Feb 15;2(2):183-90._x000D_ doi: 10.1242/bio.20123277. Epub 2012 Nov 23. PubMed PMID: 23429853; PubMed_x000D_ Central PMCID: PMC3575652.
    • _x000D_ _x000D_ _x000D_
  • 9: Raj N, Zhang L, Wei Y, Arnosti DN, Henry RW. Rbf1 degron dysfunction enhances _x000D_ cellular DNA replication. Cell Cycle. 2012 Oct 15;11(20):3731-8. doi:_x000D_ 10.4161/cc.21665. Epub 2012 Aug 16. PubMed PMID: 22895052; PubMed Central PMCID: _x000D_ PMC3495815.
    • _x000D_ _x000D_ _x000D_
  • 10: Manning AL, Longworth MS, Dyson NJ. Loss of pRB causes centromere dysfunction_x000D_ and chromosomal instability. Genes Dev. 2010 Jul 1;24(13):1364-76. doi:_x000D_ 10.1101/gad.1917310. Epub 2010 Jun 15. PubMed PMID: 20551165; PubMed Central_x000D_ PMCID: PMC2895196.
    • _x000D_ _x000D_ _x000D_
  • 11: Milet C, Rincheval-Arnold A, Mignotte B, Guénal I. The Drosophila_x000D_ retinoblastoma protein induces apoptosis in proliferating but not in post-mitotic_x000D_ cells. Cell Cycle. 2010 Jan 1;9(1):97-103. Epub 2010 Jan 5. PubMed PMID:_x000D_ 20016284.
    • _x000D_ _x000D_ _x000D_
  • 12: DiAngelo JR, Birnbaum MJ. Regulation of fat cell mass by insulin in_x000D_ Drosophila melanogaster. Mol Cell Biol. 2009 Dec;29(24):6341-52. doi:_x000D_ 10.1128/MCB.00675-09. Epub 2009 Oct 12. PubMed PMID: 19822665; PubMed Central_x000D_ PMCID: PMC2786867.
    • _x000D_ _x000D_ _x000D_
  • 13: Stasiv Y, Kuzin B, Regulski M, Tully T, Enikolopov G. Regulation of multimers_x000D_ via truncated isoforms: a novel mechanism to control nitric-oxide signaling._x000D_ Genes Dev. 2004 Aug 1;18(15):1812-23. Epub 2004 Jul 15. PubMed PMID: 15256486;_x000D_ PubMed Central PMCID: PMC517402.
    • _x000D_ _x000D_ _x000D_
  • 14: Kuzin B, Regulski M, Stasiv Y, Scheinker V, Tully T, Enikolopov G. Nitric_x000D_ oxide interacts with the retinoblastoma pathway to control eye development in_x000D_ Drosophila. Curr Biol. 2000 Apr 20;10(8):459-62. PubMed PMID: 10801421.
    • _x000D_ _x000D_ _x000D_
  • 15: Du W. Suppression of the rbf null mutants by a de2f1 allele that lacks_x000D_ transactivation domain. Development. 2000 Jan;127(2):367-79. PubMed PMID:_x000D_ 10603353.
    • _x000D_ _x000D_ _x000D_
  • 16: Dougan S, DiNardo S. Drosophila wingless generates cell type diversity among _x000D_ engrailed expressing cells. Nature. 1992 Nov 26;360(6402):347-50. PubMed PMID:_x000D_ 1280330.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Drosophila RBf1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products