Cart (0 Items)
Your cart is currently empty.
View ProductsActive
size | 15000u, 75000u, 50ug, 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Elizabethkingia miricola PNGaseF Recombinant Protein |
---|---|
Uniprot ID | P21163 |
Uniprot link | http://www.uniprot.org/uniprot/P21163 |
Origin species | Schizosaccharomyces pombe |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLSVHSDNQSQISIEVGRDAPAAAATDLSGIIGPQMTKSPASSVTHFSTPSMLPIGGTSLDDELLAPVDDL NLDLGLDDLLGDEQGANAPAIEADEQAETSSIHLPSDIMEDDSSRPAAAGVEEGQVVESATAPQQEKINPQKTVRRQRAI IDPVTELSSKQMKKQLADTSSITSPLCLNTSSIVFNATVNFTRNGKFNTSIFSSNLNPKVNELLQADFKQAILRKRKNES PEEVEPAKHQRTDTSTENQETAEVLDPEEIAAAELANITEAAIATLPQETVVQPEGEAPELGSPMGFPVTALESADDSLF DAPPVMLDEADLLGSERLDSSVSEALPSSQTAKDSLRNKWDPYTEGEKVSFQTLSAGCNREEAVQLFFDVLVLATKDVIS VKQDVAIQNEITLTAKRGMLLSSL |
Molecular weight | 45,52 kDa |
Purity estimated | 90% |
Buffer | PBS, imidazole 300mM |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
NCBI Reference | NP_588151.1 |
Aliases /Synonyms | Peptide -N-Glycosidase F, PNGase F, PNGaseF |
Reference | PX-P3070 |
Note | For research use only |
PNGase F is a recombinant glycosidase cloned from Elizabethkingia miricola and overexpressed in E. coli. It cleaves a complete glycan from a glycoprotein and it deaminates the asparagine to aspartic acid, but leaves the oligosaccharide undamaged. PNGase F will not eliminate oligosaccharides containing Alpha-(1, 3)-linked core fucose usually found in plant glycoproteins. A tri-peptide with the oligosaccharide-linked asparagine as the central residue is the minimal substrate for PNGase F.
Send us a message from the form below
Waltteri Hosia –
Was the protein active?: Yes
Very good product. I would buy again.