Name: Human 3C Protease Recombinant Enzyme (GST tag)
SKU: PX-P1106-1000U
Availability: InStock

Product name	Human 3C Protease Recombinant Enzyme (GST tag)
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKN IMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDL EGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLK KQYFVEKQAAAS
Molecular weight	46,52 kDa
Protein delivered with Tag?	Yes
Buffer	Tris-HC 50mMl pH8, NaCl 150mM, EDTA 10mM, DTT 1mM and 20% Glycerol
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Property sequence
Protein Accession	NP_740524.1
NCBI Reference	NP_740524.1
Aliases /Synonyms	GST 3C Protease, 3C-Protease
Reference	PX-P1106
Note	For research use only

Publication

1: Park N, Schweers NJ, Gustin KE. Selective Removal of FG Repeat Domains from the Nuclear Pore Complex by Enterovirus 2A(pro). J Virol. 2015 Nov;89(21):11069-79. doi: 10.1128/JVI.00956-15. Epub 2015 Aug 26. PubMed PMID: 26311873; PubMed Central PMCID: PMC4621107.
2: Katpally U, Fu TM, Freed DC, Casimiro DR, Smith TJ. Antibodies to the buried N terminus of rhinovirus VP4 exhibit cross-serotypic neutralization. J Virol. 2009 Jul;83(14):7040-8. doi: 10.1128/JVI.00557-09. Epub 2009 Apr 29. PubMed PMID: 19403680; PubMed Central PMCID: PMC2704786.
3: Stanway G, Hughes PJ, Mountford RC, Minor PD, Almond JW. The complete nucleotide sequence of a common cold virus: human rhinovirus 14. Nucleic Acids Res. 1984 Oct 25;12(20):7859-75. PubMed PMID: 6093056; PubMed Central PMCID: PMC320205.
4: Callahan PL, Mizutani S, Colonno RJ. Molecular cloning and complete sequence determination of RNA genome of human rhinovirus type 14. Proc Natl Acad Sci U S A. 1985 Feb;82(3):732-6. PubMed PMID: 2983312; PubMed Central PMCID: PMC397120.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human 3C Protease Recombinant Enzyme (GST tag)”

$392.00In stock

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Send us a message from the form below