Skip to main content
Contact +1 (919) 234-1277

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Human Aggrecan (17-392) Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Tags:
Specification
Documents
Publications
Reviews
Product nameHuman Aggrecan (17-392) Recombinant Protein
Uniprot IDQ6PID9
Uniprot linkhttp://www.uniprot.org/uniprot/Q6PID9
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGE
Molecular weight43,73 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAH36445.1
Spec:SwissProtIDQ6PID9
NCBI ReferenceAAH36445.1
Aliases /SynonymsAggrecan [17-392], Aggrecan, ACAN, Aggrecan core protein
ReferencePX-P1069
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Casa NL, Casa Junior AJ, Melo AV, Teodoro LS, Nascimento GR, Sousa AF,_x000D_ Flausino TC, Brito D, Bergamini R, Minasi LB, da Cruz AD, Vieira TC, Curado MP._x000D_ CASE-REPORT Association between an ACAN gene variable number tandem repeat_x000D_ polymorphism and lumbar disc herniation: a case control study. Genet Mol Res._x000D_ 2016 Dec 19;15(4). doi: 10.4238/gmr15048867. PubMed PMID: 28002585.
    • _x000D_ _x000D_ _x000D_
  • 2: Glant TT, Ocsko T, Markovics A, Szekanecz Z, Katz RS, Rauch TA, Mikecz K._x000D_ Characterization and Localization of Citrullinated Proteoglycan Aggrecan in Human_x000D_ Articular Cartilage. PLoS One. 2016 Mar 4;11(3):e0150784. doi:_x000D_ 10.1371/journal.pone.0150784. eCollection 2016. PubMed PMID: 26943656; PubMed_x000D_ Central PMCID: PMC4778950.
    • _x000D_ _x000D_ _x000D_
  • 3: Ristolainen H, Kilpivaara O, Kamper P, Taskinen M, Saarinen S, Leppä S,_x000D_ d'Amore F, Aaltonen LA. Identification of homozygous deletion in ACAN and other_x000D_ candidate variants in familial classical Hodgkin lymphoma by exome sequencing. Br_x000D_ J Haematol. 2015 Aug;170(3):428-31. doi: 10.1111/bjh.13295. Epub 2015 Feb 25._x000D_ PubMed PMID: 25715982.
    • _x000D_ _x000D_ _x000D_
  • 4: Pantazopoulos H, Markota M, Jaquet F, Ghosh D, Wallin A, Santos A, Caterson B,_x000D_ Berretta S. Aggrecan and chondroitin-6-sulfate abnormalities in schizophrenia and_x000D_ bipolar disorder: a postmortem study on the amygdala. Transl Psychiatry. 2015 Jan_x000D_ 20;5:e496. doi: 10.1038/tp.2014.128. PubMed PMID: 25603412; PubMed Central PMCID:_x000D_ PMC4312825.
    • _x000D_ _x000D_ _x000D_
  • 5: Cong L, Zhu Y, Pang H, Guanjun TU. The interaction between aggrecan gene VNTR _x000D_ polymorphism and obesity in predicting incident symptomatic lumbar disc_x000D_ herniation. Connect Tissue Res. 2014 Oct-Dec;55(5-6):384-90. doi:_x000D_ 10.3109/03008207.2014.959117. Epub 2014 Sep 22. PubMed PMID: 25188217.
    • _x000D_ _x000D_ _x000D_
  • 6: Gu J, Guan F, Guan G, Xu G, Wang X, Zhao W, Ji Y, Yan J. Aggrecan variable_x000D_ number of tandem repeat polymorphism and lumbar disc degeneration: a_x000D_ meta-analysis. Spine (Phila Pa 1976). 2013 Dec 1;38(25):E1600-7. doi:_x000D_ 10.1097/BRS.0000000000000012. PubMed PMID: 24296484.
    • _x000D_ _x000D_ _x000D_
  • 7: Hu G, Codina M, Fisher S. Multiple enhancers associated with ACAN suggest_x000D_ highly redundant transcriptional regulation in cartilage. Matrix Biol. 2012_x000D_ Jul;31(6):328-37. doi: 10.1016/j.matbio.2012.06.001. Epub 2012 Jul 20. PubMed_x000D_ PMID: 22820679; PubMed Central PMCID: PMC3508301.
    • _x000D_ _x000D_ _x000D_
  • 8: Eser O, Eser B, Cosar M, Erdogan MO, Aslan A, Yıldız H, Solak M, Haktanır A._x000D_ Short aggrecan gene repetitive alleles associated with lumbar degenerative disc_x000D_ disease in Turkish patients. Genet Mol Res. 2011 Aug 30;10(3):1923-30. doi:_x000D_ 10.4238/vol10-3gmr1222. PubMed PMID: 21948754.
    • _x000D_ _x000D_ _x000D_
  • 9: Gruber HE, Hoelscher GL, Ingram JA, Bethea S, Zinchenko N, Hanley EN Jr._x000D_ Variations in aggrecan localization and gene expression patterns characterize_x000D_ increasing stages of human intervertebral disk degeneration. Exp Mol Pathol. 2011_x000D_ Oct;91(2):534-9. doi: 10.1016/j.yexmp.2011.06.001. Epub 2011 Jun 12. PubMed PMID:_x000D_ 21689646.
    • _x000D_ _x000D_ _x000D_
  • 10: Stacey MW, Neumann SA, Dooley A, Segna K, Kelly RE, Nuss D, Kuhn AM, Goretsky_x000D_ MJ, Fecteau AH, Pastor A, Proud VK. Variable number of tandem repeat_x000D_ polymorphisms (VNTRs) in the ACAN gene associated with pectus excavatum. Clin_x000D_ Genet. 2010 Nov;78(5):502-4. doi: 10.1111/j.1399-0004.2010.01492.x. PubMed PMID: _x000D_ 21039430.
    • _x000D_ _x000D_ _x000D_
  • 11: Kim NK, Shin DA, Han IB, Yoo EH, Kim SH, Chung SS. The association of_x000D_ aggrecan gene polymorphism with the risk of intervertebral disc degeneration._x000D_ Acta Neurochir (Wien). 2011 Jan;153(1):129-33. doi: 10.1007/s00701-010-0831-2._x000D_ Epub 2010 Oct 10. PubMed PMID: 20936487.
    • _x000D_ _x000D_ _x000D_
  • 12: Jowitt TA, Murdoch AD, Baldock C, Berry R, Day JM, Hardingham TE. Order_x000D_ within disorder: aggrecan chondroitin sulphate-attachment region provides new_x000D_ structural insights into protein sequences classified as disordered. Proteins._x000D_ 2010 Dec;78(16):3317-27. doi: 10.1002/prot.22839. PubMed PMID: 20806220; PubMed_x000D_ Central PMCID: PMC3546398.
    • _x000D_ _x000D_ _x000D_
  • 13: Cong L, Pang H, Xuan D, Tu GJ. Association between the expression of aggrecan_x000D_ and the distribution of aggrecan gene variable number of tandem repeats with_x000D_ symptomatic lumbar disc herniation in Chinese Han of Northern China. Spine (Phila_x000D_ Pa 1976). 2010 Jun 15;35(14):1371-6. doi: 10.1097/BRS.0b013e3181c4e022. PubMed_x000D_ PMID: 20505571.
    • _x000D_ _x000D_ _x000D_
  • 14: Mashayekhi F, Shafiee G, Kazemi M, Dolati P. Lumbar disk degeneration disease_x000D_ and aggrecan gene polymorphism in northern Iran. Biochem Genet. 2010_x000D_ Aug;48(7-8):684-9. doi: 10.1007/s10528-010-9350-3. Epub 2010 May 23. PubMed PMID:_x000D_ 20496110.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human Aggrecan (17-392) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products