Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Aggrecan (17-392) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q6PID9
Molecular weight:
43,73 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Aggrecan (17-392) Recombinant Protein

Product name Human Aggrecan (17-392) Recombinant Protein
Uniprot ID Q6PID9
Uniprot link http://www.uniprot.org/uniprot/Q6PID9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGE
Molecular weight 43,73 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH36445.1
Spec:SwissProtID Q6PID9
NCBI Reference AAH36445.1
Aliases /Synonyms Aggrecan [17-392], Aggrecan, ACAN, Aggrecan core protein
Reference PX-P1069
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Aggrecan (17-392) Recombinant Protein
Uniprot ID Q6PID9
Uniprot link http://www.uniprot.org/uniprot/Q6PID9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGE
Molecular weight 43,73 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH36445.1
Spec:SwissProtID Q6PID9
NCBI Reference AAH36445.1
Aliases /Synonyms Aggrecan [17-392], Aggrecan, ACAN, Aggrecan core protein
Reference PX-P1069
Note For research use only
Molecular Constructor
Partial Yes

  • Casa NL, Casa Junior AJ, Melo AV, Teodoro LS, Nascimento GR, Sousa AF, Flausino TC, Brito D, Bergamini R, Minasi LB, da Cruz AD, Vieira TC, Curado MP. CASE-REPORT Association between an ACAN gene variable number tandem repeat polymorphism and lumbar disc herniation: a case control study. Genet Mol Res. 2016 Dec 19;15(4). doi: 10.4238/gmr15048867. PubMed PMID: 28002585.
  • Glant TT, Ocsko T, Markovics A, Szekanecz Z, Katz RS, Rauch TA, Mikecz K. Characterization and Localization of Citrullinated Proteoglycan Aggrecan in Human Articular Cartilage. PLoS One. 2016 Mar 4;11(3):e0150784. doi: 10.1371/journal.pone.0150784. eCollection 2016. PubMed PMID: 26943656; PubMed Central PMCID: PMC4778950.
  • Ristolainen H, Kilpivaara O, Kamper P, Taskinen M, Saarinen S, Leppä S, d'Amore F, Aaltonen LA. Identification of homozygous deletion in ACAN and other candidate variants in familial classical Hodgkin lymphoma by exome sequencing. Br J Haematol. 2015 Aug;170(3):428-31. doi: 10.1111/bjh.13295. Epub 2015 Feb 25. PubMed PMID: 25715982.
  • Pantazopoulos H, Markota M, Jaquet F, Ghosh D, Wallin A, Santos A, Caterson B, Berretta S. Aggrecan and chondroitin-6-sulfate abnormalities in schizophrenia and bipolar disorder: a postmortem study on the amygdala. Transl Psychiatry. 2015 Jan 20;5:e496. doi: 10.1038/tp.2014.128. PubMed PMID: 25603412; PubMed Central PMCID: PMC4312825.
  • Cong L, Zhu Y, Pang H, Guanjun TU. The interaction between aggrecan gene VNTR polymorphism and obesity in predicting incident symptomatic lumbar disc herniation. Connect Tissue Res. 2014 Oct-Dec;55(5-6):384-90. doi: 10.3109/03008207.2014.959117. Epub 2014 Sep 22. PubMed PMID: 25188217.
  • Gu J, Guan F, Guan G, Xu G, Wang X, Zhao W, Ji Y, Yan J. Aggrecan variable number of tandem repeat polymorphism and lumbar disc degeneration: a meta-analysis. Spine (Phila Pa 1976). 2013 Dec 1;38(25):E1600-7. doi: 10.1097/BRS.0000000000000012. PubMed PMID: 24296484.
  • Hu G, Codina M, Fisher S. Multiple enhancers associated with ACAN suggest highly redundant transcriptional regulation in cartilage. Matrix Biol. 2012 Jul;31(6):328-37. doi: 10.1016/j.matbio.2012.06.001. Epub 2012 Jul 20. PubMed PMID: 22820679; PubMed Central PMCID: PMC3508301.
  • Eser O, Eser B, Cosar M, Erdogan MO, Aslan A, Yıldız H, Solak M, Haktanır A. Short aggrecan gene repetitive alleles associated with lumbar degenerative disc disease in Turkish patients. Genet Mol Res. 2011 Aug 30;10(3):1923-30. doi: 10.4238/vol10-3gmr1222. PubMed PMID: 21948754.
  • Gruber HE, Hoelscher GL, Ingram JA, Bethea S, Zinchenko N, Hanley EN Jr. Variations in aggrecan localization and gene expression patterns characterize increasing stages of human intervertebral disk degeneration. Exp Mol Pathol. 2011 Oct;91(2):534-9. doi: 10.1016/j.yexmp.2011.06.001. Epub 2011 Jun 12. PubMed PMID: 21689646.
  • Stacey MW, Neumann SA, Dooley A, Segna K, Kelly RE, Nuss D, Kuhn AM, Goretsky MJ, Fecteau AH, Pastor A, Proud VK. Variable number of tandem repeat polymorphisms (VNTRs) in the ACAN gene associated with pectus excavatum. Clin Genet. 2010 Nov;78(5):502-4. doi: 10.1111/j.1399-0004.2010.01492.x. PubMed PMID: 21039430.
  • Kim NK, Shin DA, Han IB, Yoo EH, Kim SH, Chung SS. The association of aggrecan gene polymorphism with the risk of intervertebral disc degeneration. Acta Neurochir (Wien). 2011 Jan;153(1):129-33. doi: 10.1007/s00701-010-0831-2. Epub 2010 Oct 10. PubMed PMID: 20936487.
  • Jowitt TA, Murdoch AD, Baldock C, Berry R, Day JM, Hardingham TE. Order within disorder: aggrecan chondroitin sulphate-attachment region provides new structural insights into protein sequences classified as disordered. Proteins. 2010 Dec;78(16):3317-27. doi: 10.1002/prot.22839. PubMed PMID: 20806220; PubMed Central PMCID: PMC3546398.
  • Cong L, Pang H, Xuan D, Tu GJ. Association between the expression of aggrecan and the distribution of aggrecan gene variable number of tandem repeats with symptomatic lumbar disc herniation in Chinese Han of Northern China. Spine (Phila Pa 1976). 2010 Jun 15;35(14):1371-6. doi: 10.1097/BRS.0b013e3181c4e022. PubMed PMID: 20505571.
  • Mashayekhi F, Shafiee G, Kazemi M, Dolati P. Lumbar disk degeneration disease and aggrecan gene polymorphism in northern Iran. Biochem Genet. 2010 Aug;48(7-8):684-9. doi: 10.1007/s10528-010-9350-3. Epub 2010 May 23. PubMed PMID: 20496110.

There are no reviews yet.

Be the first to review “Human Aggrecan (17-392) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products