Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Phenylalanine-4-hydroxylase(PAH)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P00439
Molecular weight:
37.49 kDa

Original price was: $262.00.Current price is: $218.00.

50ug 17% OFF + 218 loyalty points
Gly103–Thr427 N terminus His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Phenylalanine-4-hydroxylase(PAH)

Product name Phenylalanine-4-hydroxylase(PAH)
Uniprot ID P00439
Uniprot link https://www.uniprot.org/uniprot/P00439
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight 37.49 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Thr427
Protein Accession P00439
Spec:Entrez GeneID 5053
Spec:NCBI Gene Aliases PH; PKU; PKU1
Spec:SwissProtID Q8TC14
NCBI Reference P00439
Aliases /Synonyms Phe-4-monooxygenase
Reference PX-P4804
Note For research use only
Molecular Constructor
Gly103–Thr427 N terminus His
Product name Phenylalanine-4-hydroxylase(PAH)
Uniprot ID P00439
Uniprot link https://www.uniprot.org/uniprot/P00439
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight 37.49 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Thr427
Protein Accession P00439
Spec:Entrez GeneID 5053
Spec:NCBI Gene Aliases PH; PKU; PKU1
Spec:SwissProtID Q8TC14
NCBI Reference P00439
Aliases /Synonyms Phe-4-monooxygenase
Reference PX-P4804
Note For research use only
Molecular Constructor
Gly103–Thr427 N terminus His
Product name PX-P4804-1MG
Uniprot ID P00439
Uniprot link https://www.uniprot.org/uniprot/P00439
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight 37.49 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Thr427
Protein Accession P00439
Spec:Entrez GeneID 5053
Spec:NCBI Gene Aliases PH; PKU; PKU1
Spec:SwissProtID Q8TC14
NCBI Reference P00439
Aliases /Synonyms Phe-4-monooxygenase
Reference PX-P4804
Note For research use only
Molecular Constructor
Gly103–Thr427 N terminus His

Phenylalanine-4-hydroxylase(PAH)

There are no reviews yet.

Be the first to review “Phenylalanine-4-hydroxylase(PAH)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products