Name: Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)
SKU: PX-P4796-10
Availability: InStock

Product name	Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)
Uniprot ID	O14672
Uniprot link	https://www.uniprot.org/uniprot/O14672
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	TTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS
Molecular weight	32.34 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Thr214-Ser504
Protein Accession	O14672
Spec:Entrez GeneID	102
Spec:NCBI Gene Aliases	RAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717
Spec:SwissProtID	Q92650
NCBI Reference	O14672
Aliases /Synonyms	ADAM 10，CDw156，Kuzbanian protein homolog，Mammalian disintegrin-metalloprotease，CD_antigen: CD156c，KUZ, MADM
Reference	PX-P4796
Note	For research use only

No Products found