Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14672
Molecular weight:
32.34 kDa

$169.00

100ug + 169 loyalty points
Thr214–Ser504 N terminus His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)

Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)

Product name Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)
Uniprot ID O14672
Uniprot link https://www.uniprot.org/uniprot/O14672
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence TTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS
Molecular weight 32.34 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr214-Ser504
Protein Accession O14672
Spec:Entrez GeneID 102
Spec:NCBI Gene Aliases RAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717
Spec:SwissProtID Q92650
NCBI Reference O14672
Aliases /Synonyms ADAM 10，CDw156，Kuzbanian protein homolog，Mammalian disintegrin-metalloprotease，CD_antigen: CD156c，KUZ, MADM
Reference PX-P4796
Note For research use only
Molecular Constructor
Thr214–Ser504 N terminus His
Product name Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)
Uniprot ID O14672
Uniprot link https://www.uniprot.org/uniprot/O14672
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence TTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS
Molecular weight 32.34 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr214-Ser504
Protein Accession O14672
Spec:Entrez GeneID 102
Spec:NCBI Gene Aliases RAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717
Spec:SwissProtID Q92650
NCBI Reference O14672
Aliases /Synonyms ADAM 10，CDw156，Kuzbanian protein homolog，Mammalian disintegrin-metalloprotease，CD_antigen: CD156c，KUZ, MADM
Reference PX-P4796
Note For research use only
Molecular Constructor
Thr214–Ser504 N terminus His

There are no reviews yet.

Be the first to review “Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products