Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-31 receptor subunit alpha(IL31RA)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8NI17
Molecular weight:
55.75 kDa

$169.00

100ug + 169 loyalty points
Val130–Asp622 N terminus His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-31 receptor subunit alpha(IL31RA)

Product name Interleukin-31 receptor subunit alpha(IL31RA)
Uniprot ID Q8NI17
Uniprot link https://www.uniprot.org/uniprot/Q8NI17
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD
Molecular weight 55.75 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val130-Asp622
Protein Accession Q8NI17
Spec:Entrez GeneID 133396
Spec:NCBI Gene Aliases CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17
Spec:SwissProtID Q8WYJ0
NCBI Reference Q8NI17
Aliases /Synonyms IL-31 receptor subunit alpha,IL-31R subunit alpha,IL-31R-alpha,IL-31RA,Cytokine receptor-like 3,GLM-R,hGLM-R,Gp130-like monocyte receptor,Gp130-like receptor,ZcytoR17,CRL3, GPL
Reference PX-P4802
Note For research use only
Molecular Constructor
Val130–Asp622 N terminus His
Product name Interleukin-31 receptor subunit alpha(IL31RA)
Uniprot ID Q8NI17
Uniprot link https://www.uniprot.org/uniprot/Q8NI17
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD
Molecular weight 55.75 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val130-Asp622
Protein Accession Q8NI17
Spec:Entrez GeneID 133396
Spec:NCBI Gene Aliases CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17
Spec:SwissProtID Q8WYJ0
NCBI Reference Q8NI17
Aliases /Synonyms IL-31 receptor subunit alpha,IL-31R subunit alpha,IL-31R-alpha,IL-31RA,Cytokine receptor-like 3,GLM-R,hGLM-R,Gp130-like monocyte receptor,Gp130-like receptor,ZcytoR17,CRL3, GPL
Reference PX-P4802
Note For research use only
Molecular Constructor
Val130–Asp622 N terminus His

Interleukin-2 receptor subunit alpha(IL2RA) binds to Daclizumab Biosimilar - Anti-IL2RA mAb in indirect ELISA assay

Interleukin-2 receptor subunit alpha(IL2RA) binds to Daclizumab Biosimilar - Anti-IL2RA mAb in indirect ELISA assay

Immobilized Interleukin-2 receptor subunit alpha(IL2RA) (cat. No.PX-P4704) at 0.5µg/mL (100µL/well) can bind Daclizumab Biosimilar - Anti-IL2RA mAb (cat. No.PX-TA1038) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 175.8M.

There are no reviews yet.

Be the first to review “Interleukin-31 receptor subunit alpha(IL31RA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products