Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Interleukin-31 receptor subunit alpha(IL31RA) |
|---|---|
| Uniprot ID | Q8NI17 |
| Uniprot link | https://www.uniprot.org/uniprot/Q8NI17 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD |
| Molecular weight | 55.75 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val130-Asp622 |
| Protein Accession | Q8NI17 |
| Spec:Entrez GeneID | 133396 |
| Spec:NCBI Gene Aliases | CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17 |
| Spec:SwissProtID | Q8WYJ0 |
| NCBI Reference | Q8NI17 |
| Aliases /Synonyms | IL-31 receptor subunit alpha,IL-31R subunit alpha,IL-31R-alpha,IL-31RA,Cytokine receptor-like 3,GLM-R,hGLM-R,Gp130-like monocyte receptor,Gp130-like receptor,ZcytoR17,CRL3, GPL |
| Reference | PX-P4802 |
| Note | For research use only |
Immobilized Interleukin-2 receptor subunit alpha(IL2RA) (cat. No.PX-P4704) at 0.5µg/mL (100µL/well) can bind Daclizumab Biosimilar - Anti-IL2RA mAb (cat. No.PX-TA1038) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 175.8M.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.