Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human CD123 Recombinant Protein |
---|---|
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MKLHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAENLYFQGTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW |
Molecular weight | 23.70 kDa |
Protein delivered with Tag? | Yes |
Buffer | 50mM Tris, NaCl 150mM , DTT 1mM pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Unknown |
Protein Accession | XP_005274489 |
NCBI Reference | XP_005274489 |
Aliases /Synonyms | CD123 |
Reference | PX-P2057 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.