Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human CD123 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human CD123 Recombinant Protein |
|---|---|
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MKLHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAENLYFQGTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW |
| Molecular weight | 23.70 kDa |
| Protein delivered with Tag? | Yes |
| Buffer | 50mM Tris, NaCl 150mM , DTT 1mM pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Unknown |
| Protein Accession | XP_005274489 |
| NCBI Reference | XP_005274489 |
| Aliases /Synonyms | CD123 |
| Reference | PX-P2057 |
| Note | For research use only |
Related products
Biosimilar
Nofetumomab Biosimilar – Anti-CD20/MS4A1 mAb – Research Grade
PX-TA1093 238$
Biosimilar
Flotetuzumab Biosimilar – Anti-CD3E, IL3RA, CD123 mAb – Research Grade
PX-TA1456 238$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.