Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD123 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Molecular weight:
23.70 kDa

$250.00

50ug + 250 loyalty points
Unknown Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD123 Recombinant Protein

Human CD123 Recombinant Protein

Product name Human CD123 Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MKLHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAENLYFQGTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW
Molecular weight 23.70 kDa
Protein delivered with Tag? Yes
Buffer 50mM Tris, NaCl 150mM , DTT 1mM pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession XP_005274489
NCBI Reference XP_005274489
Aliases /Synonyms CD123
Reference PX-P2057
Note For research use only
Molecular Constructor
Unknown Yes
Product name Human CD123 Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MKLHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAENLYFQGTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW
Molecular weight 23.70 kDa
Protein delivered with Tag? Yes
Buffer 50mM Tris, NaCl 150mM , DTT 1mM pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession XP_005274489
NCBI Reference XP_005274489
Aliases /Synonyms CD123
Reference PX-P2057
Note For research use only
Molecular Constructor
Unknown Yes

There are no reviews yet.

Be the first to review “Human CD123 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products