Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 20ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human CD81 Recombinant Protein |
|---|---|
| Uniprot ID | P60033 |
| Uniprot link | http://www.uniprot.org/uniprot/P60033 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
| Molecular weight | 10.59 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS,pH 7.5 urea +8M |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| NCBI Reference | P60033 |
| Aliases /Synonyms | CD81, S5.7, TAPA1, TSPAN28, Tetraspanin 28, Target Of Antiproliferative Antibody 1, 26 kDa cell surface protein TAPA-1 |
| Reference | PX-P3039 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.