Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human CD86, B7-2 recombinant protein |
|---|---|
| Uniprot ID | P42081 |
| Uniprot link | http://www.uniprot.org/uniprot/P42081 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH |
| Molecular weight | 28.92kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2 |
| Reference | PX-P4041 |
| Note | For research use only |
Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein expressed in antigen presenting cells, which provides co-stimulatory signals necessary for T cell activation and survival. It is a ligand for two different proteins on the cell surface. T: CD28 (for self-regulation and cell-cell binding) and CTLA-4 (to attenuate cell regulation and separation). CD86 and CD80 act together on primary T cells. This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. The protein is expressed because it contains antigens, and is a ligand for two proteins on the surface of T cells, the CD28 antigen and the cytotoxic T lymph.
Send us a message from the form below
Reviews
There are no reviews yet.