Skip to main content
Contact +1 (919) 234-1277

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Human COL11A Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Tags:
Specification
Documents
Publications
Reviews
Product nameHuman COL11A Recombinant Protein
Uniprot IDP12107
Uniprot linkhttp://www.uniprot.org/uniprot/P12107
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPR GSTAIGMKETAAAKFERQHMDSPDLGTGGGSGDDDDKSPMGYRGSEFSSAPKAAQAQEPQIDEANIVDDFQEYNYGTMES YQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSP PNEEFGPGVPAETDITETSINGHGAY
Molecular weight48,19 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferTrisHCl 50mM. PBS if dialysis
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAF04724.1
Spec:Entrez GeneID1301
Spec:NCBI Gene AliasesCOLL6, CO11A1, STL2
Spec:SwissProtIDP12107
NCBI ReferenceAAF04724.1
Aliases /SynonymsCO11A1, COBA1, COL11A1, COLL6, Collagen alpha-1(XI) chain, collagen XI, alpha-1 polypeptide, collagen, type XI, alpha 1, STL2
ReferencePX-P1081
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Chen S, Zhou K, Yang L, Ding G, Li H. Racial Differences in Esophageal_x000D_ Squamous Cell Carcinoma: Incidence and Molecular Features. Biomed Res Int._x000D_ 2017;2017:1204082. doi: 10.1155/2017/1204082. Epub 2017 Mar 14. PubMed PMID:_x000D_ 28393072; PubMed Central PMCID: PMC5368356.
    • _x000D_ _x000D_ _x000D_
  • 2: Li A, Li J, Lin J, Zhuo W, Si J. COL11A1 is overexpressed in gastric cancer_x000D_ tissues and regulates proliferation, migration and invasion of HGC-27 gastric_x000D_ cancer cells in vitro. Oncol Rep. 2017 Jan;37(1):333-340. doi:_x000D_ 10.3892/or.2016.5276. Epub 2016 Nov 25. PubMed PMID: 28004111.
    • _x000D_ _x000D_ _x000D_
  • 3: Wang J, Zhang C, Wu SG, Shang C, Huang L, Zhang T, Zhang W, Zhang Y, Zhang L. _x000D_ Additional Evidence Supports Association of Common Variants in COL11A1 with_x000D_ Increased Risk of Hip Osteoarthritis Susceptibility. Genet Test Mol Biomarkers._x000D_ 2017 Feb;21(2):86-91. doi: 10.1089/gtmb.2016.0308. Epub 2016 Dec 12. PubMed PMID:_x000D_ 27936936.
    • _x000D_ _x000D_ _x000D_
  • 4: Shen L, Yang M, Lin Q, Zhang Z, Zhu B, Miao C. COL11A1 is overexpressed in_x000D_ recurrent non-small cell lung cancer and promotes cell proliferation, migration, _x000D_ invasion and drug resistance. Oncol Rep. 2016 Aug;36(2):877-85. doi:_x000D_ 10.3892/or.2016.4869. Epub 2016 Jun 10. PubMed PMID: 27373316.
    • _x000D_ _x000D_ _x000D_
  • 5: Zhang D, Zhu H, Harpaz N. Overexpression of α1 chain of type XI collagen_x000D_ (COL11A1) aids in the diagnosis of invasive carcinoma in endoscopically removed_x000D_ malignant colorectal polyps. Pathol Res Pract. 2016 Jun;212(6):545-8. doi:_x000D_ 10.1016/j.prp.2016.03.005. Epub 2016 Mar 16. PubMed PMID: 27021528.
    • _x000D_ _x000D_ _x000D_
  • 6: Kleinert R, Prenzel K, Stoecklein N, Alakus H, Bollschweiler E, Hölscher A,_x000D_ Warnecke-Eberz U. Gene Expression of Col11A1 Is a Marker Not only for Pancreas_x000D_ Carcinoma But also for Adenocarcinoma of the Papilla of Vater, Discriminating_x000D_ Between Carcinoma and Chronic Pancreatitis. Anticancer Res. 2015_x000D_ Nov;35(11):6153-8. PubMed PMID: 26504042.
    • _x000D_ _x000D_ _x000D_
  • 7: Freire J, García-Berbel L, García-Berbel P, Pereda S, Azueta A, García-Arranz _x000D_ P, De Juan A, Vega A, Hens Á, Enguita A, Muñoz-Cacho P, Gómez-Román J. Collagen_x000D_ Type XI Alpha 1 Expression in Intraductal Papillomas Predicts Malignant_x000D_ Recurrence. Biomed Res Int. 2015;2015:812027. doi: 10.1155/2015/812027. Epub 2015_x000D_ Sep 13. PubMed PMID: 26448946; PubMed Central PMCID: PMC4584034.
    • _x000D_ _x000D_ _x000D_
  • 8: Wu YH, Chang TH, Huang YF, Chen CC, Chou CY. COL11A1 confers chemoresistance_x000D_ on ovarian cancer cells through the activation of Akt/c/EBPβ pathway and PDK1_x000D_ stabilization. Oncotarget. 2015 Sep 15;6(27):23748-63. PubMed PMID: 26087191;_x000D_ PubMed Central PMCID: PMC4695149.
    • _x000D_ _x000D_ _x000D_
  • 9: Vázquez-Villa F, García-Ocaña M, Galván JA, García-Martínez J, García-Pravia_x000D_ C, Menéndez-Rodríguez P, González-del Rey C, Barneo-Serra L, de Los Toyos JR._x000D_ COL11A1/(pro)collagen 11A1 expression is a remarkable biomarker of human invasive_x000D_ carcinoma-associated stromal cells and carcinoma progression. Tumour Biol. 2015_x000D_ Apr;36(4):2213-22. doi: 10.1007/s13277-015-3295-4. Epub 2015 Mar 12. Review._x000D_ PubMed PMID: 25761876.
    • _x000D_ _x000D_ _x000D_
  • 10: Raglow Z, Thomas SM. Tumor matrix protein collagen XIα1 in cancer. Cancer_x000D_ Lett. 2015 Feb 28;357(2):448-53. doi: 10.1016/j.canlet.2014.12.011. Epub 2014 Dec_x000D_ 12. Review. PubMed PMID: 25511741; PubMed Central PMCID: PMC4307931.
    • _x000D_ _x000D_ _x000D_
  • 11: Galván JA, García-Martínez J, Vázquez-Villa F, García-Ocaña M, García-Pravia _x000D_ C, Menéndez-Rodríguez P, González-del Rey C, Barneo-Serra L, de los Toyos JR._x000D_ Validation of COL11A1/procollagen 11A1 expression in TGF-β1-activated_x000D_ immortalised human mesenchymal cells and in stromal cells of human colon_x000D_ adenocarcinoma. BMC Cancer. 2014 Nov 23;14:867. doi: 10.1186/1471-2407-14-867._x000D_ PubMed PMID: 25417197; PubMed Central PMCID: PMC4246482.
    • _x000D_ _x000D_ _x000D_
  • 12: Freire J, Domínguez-Hormaetxe S, Pereda S, De Juan A, Vega A, Simón L,_x000D_ Gómez-Román J. Collagen, type XI, alpha 1: an accurate marker for differential_x000D_ diagnosis of breast carcinoma invasiveness in core needle biopsies. Pathol Res_x000D_ Pract. 2014 Dec;210(12):879-84. doi: 10.1016/j.prp.2014.07.012. Epub 2014 Aug 8. _x000D_ PubMed PMID: 25175819.
    • _x000D_ _x000D_ _x000D_
  • 13: Hufnagel SB, Weaver KN, Hufnagel RB, Bader PI, Schorry EK, Hopkin RJ. A novel_x000D_ dominant COL11A1 mutation resulting in a severe skeletal dysplasia. Am J Med_x000D_ Genet A. 2014 Oct;164A(10):2607-12. doi: 10.1002/ajmg.a.36688. Epub 2014 Aug 4._x000D_ PubMed PMID: 25091507.
    • _x000D_ _x000D_ _x000D_
  • 14: García-Pravia C, Galván JA, Gutiérrez-Corral N, Solar-García L, García-Pérez _x000D_ E, García-Ocaña M, Del Amo-Iribarren J, Menéndez-Rodríguez P, García-García J, de_x000D_ Los Toyos JR, Simón-Buela L, Barneo L. Overexpression of COL11A1 by_x000D_ cancer-associated fibroblasts: clinical relevance of a stromal marker in_x000D_ pancreatic cancer. PLoS One. 2013 Oct 23;8(10):e78327. doi:_x000D_ 10.1371/journal.pone.0078327. eCollection 2013. PubMed PMID: 24194920; PubMed_x000D_ Central PMCID: PMC3808536.
    • _x000D_ _x000D_ _x000D_
  • 15: Wu YH, Chang TH, Huang YF, Huang HD, Chou CY. COL11A1 promotes tumor_x000D_ progression and predicts poor clinical outcome in ovarian cancer. Oncogene. 2014 _x000D_ Jun 26;33(26):3432-40. doi: 10.1038/onc.2013.307. Epub 2013 Aug 12. PubMed PMID: _x000D_ 23934190.
    • _x000D_ _x000D_ _x000D_
  • 16: Richards AJ, Fincham GS, McNinch A, Hill D, Poulson AV, Castle B, Lees MM,_x000D_ Moore AT, Scott JD, Snead MP. Alternative splicing modifies the effect of_x000D_ mutations in COL11A1 and results in recessive type 2 Stickler syndrome with_x000D_ profound hearing loss. J Med Genet. 2013 Nov;50(11):765-71. doi:_x000D_ 10.1136/jmedgenet-2012-101499. Epub 2013 Aug 6. PubMed PMID: 23922384; PubMed_x000D_ Central PMCID: PMC3812854.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human COL11A Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products