Skip to main content

Human PAFAH-LpPLA2-PLA2G7 recombinant protein

Reference:
Size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Mammalian cells

Applications

Elisa, WB

Product nameHuman PAFAH-LpPLA2-PLA2G7 recombinant protein
Uniprot IDQ13093 
Uniprot linkhttp://www.uniprot.org/uniprot/Q13093 
Origin speciesHomo sapiens (Human)
Expression systemEukaryotic expression
SequenceMVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTF LRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSE YFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHK DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNGSHHHHHH
Molecular weight50.94kDa
Protein delivered with Tag?Yes
Purity estimated50%
BufferPBS, pH 7.5
FormLyophilized
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesMammalian cells
Fragment TypeFull-length
Aliases /SynonymsPLA2G7, PAF-AH, PAFAH, Lp-PLA2, LDL-PLA2, Platelet Activating Factor Acetylhydrolase,Plasma, Phospholipase A2,Group VII, LDL-associated phospholipase A2
ReferencePX-P4061
NoteFor research use only

Description of Human PAFAH-LpPLA2-PLA2G7 recombinant protein

General Information about Human PAFAH/ LpPLA2/PLA2G7 recombinant protein

Lipoprotein-related phospholipase A2 (Lp-PLA2), also known as platelet activating factor acetyl hydrolase (PAF-AH), is a phospholipase A2 enzyme, which is encoded by the PLA2G7 gene in humans. Lp-PLA2 is a 45 kD protein of 441 amino acids. It is one of several PAF acetyl hydrolase enzymes. Lp-PLA2 is carried mainly with low-density lipoprotein (LDL) in the blood. Less than 20% are related to HDL. Several tests have shown that HDL-related Lp-PLA2 can significantly promote the anti-cancer effects of HDL. It is an enzyme produced by inflammatory cells that can hydrolyze oxidized phospholipids in LDL. Lp-PLA2 is a platelet activation factor (PAF) acetyl hydrolase, a secreted enzyme that can catalyze the degradation of PAF in inactive products by hydrolyzing the acetyl group at the sn-2 position, producing biologically inert products LYSO-PAF and acetate. Lp-PLA2 is involved in the development of atherosclerosis, and this discovery has aroused interest as a potential therapeutic target. In human atherosclerotic lesions, two main sources of Lp-PLA2 can be identified, including the source of LDL-binding intolerance (through the circulation) and the source of de novo synthesis of inflammatory plaque cells (Macrophages, T cells, mast cells). It is used as a marker of heart disease.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human PAFAH-LpPLA2-PLA2G7 recombinant protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products