Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human PAFAH-LpPLA2-PLA2G7 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q13093 
Molecular weight:
50.94kDa

$250.00

+ 250 loyalty points
Full-length Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human PAFAH-LpPLA2-PLA2G7 recombinant protein

Product name Human PAFAH-LpPLA2-PLA2G7 recombinant protein
Uniprot ID Q13093 
Uniprot link http://www.uniprot.org/uniprot/Q13093 
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTF LRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSE YFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHK DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNGSHHHHHH
Molecular weight 50.94kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms PLA2G7, PAF-AH, PAFAH, Lp-PLA2, LDL-PLA2, Platelet Activating Factor Acetylhydrolase,Plasma, Phospholipase A2,Group VII, LDL-associated phospholipase A2
Reference PX-P4061
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human PAFAH-LpPLA2-PLA2G7 recombinant protein
Uniprot ID Q13093 
Uniprot link http://www.uniprot.org/uniprot/Q13093 
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTF LRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSE YFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHK DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNGSHHHHHH
Molecular weight 50.94kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms PLA2G7, PAF-AH, PAFAH, Lp-PLA2, LDL-PLA2, Platelet Activating Factor Acetylhydrolase,Plasma, Phospholipase A2,Group VII, LDL-associated phospholipase A2
Reference PX-P4061
Note For research use only
Molecular Constructor
Full-length Yes

General Information about Human PAFAH/ LpPLA2/PLA2G7 recombinant protein

Lipoprotein-related phospholipase A2 (Lp-PLA2), also known as platelet activating factor acetyl hydrolase (PAF-AH), is a phospholipase A2 enzyme, which is encoded by the PLA2G7 gene in humans. Lp-PLA2 is a 45 kD protein of 441 amino acids. It is one of several PAF acetyl hydrolase enzymes. Lp-PLA2 is carried mainly with low-density lipoprotein (LDL) in the blood. Less than 20% are related to HDL. Several tests have shown that HDL-related Lp-PLA2 can significantly promote the anti-cancer effects of HDL. It is an enzyme produced by inflammatory cells that can hydrolyze oxidized phospholipids in LDL. Lp-PLA2 is a platelet activation factor (PAF) acetyl hydrolase, a secreted enzyme that can catalyze the degradation of PAF in inactive products by hydrolyzing the acetyl group at the sn-2 position, producing biologically inert products LYSO-PAF and acetate. Lp-PLA2 is involved in the development of atherosclerosis, and this discovery has aroused interest as a potential therapeutic target. In human atherosclerotic lesions, two main sources of Lp-PLA2 can be identified, including the source of LDL-binding intolerance (through the circulation) and the source of de novo synthesis of inflammatory plaque cells (Macrophages, T cells, mast cells). It is used as a marker of heart disease.

There are no reviews yet.

Be the first to review “Human PAFAH-LpPLA2-PLA2G7 recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products