Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15661
Molecular weight:
31.23 kDa

$250.00

50ug + 250 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein

Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein

Product name Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein
Uniprot ID Q15661
Uniprot link http://www.uniprot.org/uniprot/Q15661
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPGSHHHHHH
Molecular weight 31.23 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaCl 150mM, Tris-HCl 50 mM, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference Q15661
Aliases /Synonyms TPSAB1, Tryptase Alpha/Beta 1, Tryptase Alpha II, Tryptase Beta I, Tryptase-I, Tryptase-II, Tryptase-III,Tryptase, TPS
Reference PX-P3015
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein
Uniprot ID Q15661
Uniprot link http://www.uniprot.org/uniprot/Q15661
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPGSHHHHHH
Molecular weight 31.23 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaCl 150mM, Tris-HCl 50 mM, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference Q15661
Aliases /Synonyms TPSAB1, Tryptase Alpha/Beta 1, Tryptase Alpha II, Tryptase Beta I, Tryptase-I, Tryptase-II, Tryptase-III,Tryptase, TPS
Reference PX-P3015
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products