Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

FAS Protein- Human Factor Related Apoptosis Recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25445
Molecular weight:
20,22 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
FAS Protein- Human Factor Related Apoptosis Recombinant protein

FAS Protein- Human Factor Related Apoptosis Recombinant protein

Product name FAS Protein- Human Factor Related Apoptosis Recombinant protein
Uniprot ID P25445
Uniprot link http://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGSHHHHHH
Molecular weight 20,22 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

FAS protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms ALPS 1A, ALPS1A, APO 1, Apo 1 antigen, APO 1 cell surface antigen, Apo-1 antigen, APO1, Apo1 antigen, APO1 cell surface antigen, Apoptosis antigen 1, Apoptosis mediating surface antigen FAS, Apoptosis-mediating surface antigen FAS, APT 1, APT1, CD 95, CD 95 antigen, CD95, CD95 antigen, Delta Fas, Delta Fas/APO 1/CD95, Delta Fas/APO1/CD95, Fas, Fas (TNF receptor superfamily, member 6), FAS 1, FAS 827dupA, Fas AMA, FAS Antigen, Fas cell surface death receptor, FAS1, FASLG receptor, FASTM, sFAS, Surface antigen APO1, TNF receptor superfamily, member 6, TNFRSF 6, TNFRSF6, TNR6_HUMAN, Tumor necrosis factor receptor superfamily member 6
Reference PX-P4017
Note For research use only
Molecular Constructor
Partial Yes
Product name FAS Protein- Human Factor Related Apoptosis Recombinant protein
Uniprot ID P25445
Uniprot link http://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGSHHHHHH
Molecular weight 20,22 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

FAS protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms ALPS 1A, ALPS1A, APO 1, Apo 1 antigen, APO 1 cell surface antigen, Apo-1 antigen, APO1, Apo1 antigen, APO1 cell surface antigen, Apoptosis antigen 1, Apoptosis mediating surface antigen FAS, Apoptosis-mediating surface antigen FAS, APT 1, APT1, CD 95, CD 95 antigen, CD95, CD95 antigen, Delta Fas, Delta Fas/APO 1/CD95, Delta Fas/APO1/CD95, Fas, Fas (TNF receptor superfamily, member 6), FAS 1, FAS 827dupA, Fas AMA, FAS Antigen, Fas cell surface death receptor, FAS1, FASLG receptor, FASTM, sFAS, Surface antigen APO1, TNF receptor superfamily, member 6, TNFRSF 6, TNFRSF6, TNR6_HUMAN, Tumor necrosis factor receptor superfamily member 6
Reference PX-P4017
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “FAS Protein- Human Factor Related Apoptosis Recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products