Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD120b/TNFRSF1B/TNFR2 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P20333
Molecular weight:
28.3 kDa

$380.00

100 ug + 380 loyalty points
Leu23–Asp257 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD120b/TNFRSF1B/TNFR2 recombinant protein

Human CD120b/TNFRSF1B/TNFR2 recombinant protein

Product name Human CD120b/TNFRSF1B/TNFR2 recombinant protein
Uniprot ID P20333
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Molecular weight 28.3 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu23-Asp257
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B
Reference PX-P6584
Note For research use only.
Molecular Constructor
Leu23–Asp257 His

There are no reviews yet.

Be the first to review “Human CD120b/TNFRSF1B/TNFR2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products