Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CEACAM7 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q14002
Molecular weight:
11.77kDa

Original price was: $402.00.Current price is: $350.00.

50ug 13% OFF + 350 loyalty points
Thr36–Phe142 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
CEACAM7 recombinant protein

CEACAM7 recombinant protein

Product name PX-P5132-100
Uniprot ID Q14002
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF
Molecular weight 11.77kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr36-Phe142
Protein Accession Q14002
Aliases /Synonyms CGM2
Reference PX-P5132
Note For research use only
Molecular Constructor
Thr36–Phe142 His
Product name PX-P5132-1MG
Uniprot ID Q14002
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF
Molecular weight 11.77kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr36-Phe142
Protein Accession Q14002
Aliases /Synonyms CGM2
Reference PX-P5132
Note For research use only
Molecular Constructor
Thr36–Phe142 His
Product name PX-P5132-50
Uniprot ID Q14002
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF
Molecular weight 11.77kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr36-Phe142
Protein Accession Q14002
Aliases /Synonyms CGM2
Reference PX-P5132
Note For research use only
Molecular Constructor
Thr36–Phe142 His

CEACAM7 recombinant protein

There are no reviews yet.

Be the first to review “CEACAM7 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products