Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TNFSF9-TNFSF4-1BBL recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P41273
Molecular weight:
22.64kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TNFSF9-TNFSF4-1BBL recombinant protein

Product name Human TNFSF9-TNFSF4-1BBL recombinant protein
Uniprot ID P41273
Uniprot link http://www.uniprot.org/uniprot/P41273
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Molecular weight 22.64kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9
Reference PX-P4060
Note For research use only
Molecular Constructor
Partial Yes
Product name Human TNFSF9-TNFSF4-1BBL recombinant protein
Uniprot ID P41273
Uniprot link http://www.uniprot.org/uniprot/P41273
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Molecular weight 22.64kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9
Reference PX-P4060
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human TNFSF9-TNFSF4-1BBL recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products