Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade

Product name Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade
Uniprot ID P01374
Source CAS 1202526-59-7
Species Humanized
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pateclizumab,MLTA3698A,PRO283698,RG7416,LTA, TNFSF1,anti-LTA, TNFSF1
Reference PX-TA1273
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade
Uniprot ID P01374
Source CAS 1202526-59-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pateclizumab,MLTA3698A,PRO283698,RG7416,LTA, TNFSF1,anti-LTA, TNFSF1
Reference PX-TA1273
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1273-50
Uniprot ID P01374
Source CAS 1202526-59-7
Species Humanized
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pateclizumab,MLTA3698A,PRO283698,RG7416,LTA, TNFSF1,anti-LTA, TNFSF1
Reference PX-TA1273
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb is a monoclonal antibody (mAb) that has been developed as a biosimilar to the original Pateclizumab, which is a humanized mAb. This biosimilar has been designed to target lymphotoxin-alpha (LTA) and tumor necrosis factor superfamily member 1 (TNFSF1), both of which are important therapeutic targets in various diseases. In this article, we will explore the structure, activity, and applications of Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb.

Structure of Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb is a recombinant, fully humanized IgG1 mAb with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each consisting of constant and variable regions. The variable regions of the antibody are responsible for binding to the target molecules, LTA and TNFSF1.

Activity of Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb exerts its activity by binding to LTA and TNFSF1, which are both pro-inflammatory cytokines involved in various disease processes. LTA is a potent inducer of inflammation and is known to play a key role in the development of autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus. TNFSF1 is also involved in inflammation and has been linked to diseases such as psoriasis and inflammatory bowel disease.

By binding to LTA and TNFSF1, Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb blocks their activity and reduces inflammation. This can lead to the improvement of symptoms and disease progression in patients with these conditions.

Applications of Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb has potential applications in various diseases where LTA and TNFSF1 play a role. It is currently being studied in clinical trials for the treatment of rheumatoid arthritis, systemic lupus erythematosus, psoriasis, and inflammatory bowel disease.

In rheumatoid arthritis, Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb has shown promising results in reducing disease activity and improving symptoms in patients who have not responded well to other treatments. It has also shown potential in slowing down joint damage and improving physical function.

In systemic lupus erythematosus, Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb has shown potential in reducing disease activity and improving organ involvement. It has also been found to be well-tolerated in patients with this condition.

In psoriasis, Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb has shown promising results in reducing skin lesions and improving quality of life in patients who have not responded well to other treatments.

In inflammatory bowel disease, Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb has shown potential in reducing disease activity and improving symptoms in patients with moderate to severe Crohn’s disease.

Conclusion

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb is a promising therapeutic option for various diseases where LTA and TNFSF1 play a role. Its structure, activity, and potential applications make it a valuable addition to the treatment options available for patients with conditions such as rhe

SDS-PAGE for Pateclizumab Biosimilar - Anti-LTA;TNF-beta mAb - Research Grade

SDS-PAGE for Pateclizumab Biosimilar - Anti-LTA;TNF-beta mAb - Research Grade

Pateclizumab Biosimilar - Anti-LTA;TNF-beta mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products