Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Galectin-9(LGALS9)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O00182-2
Molecular weight:
61.76kDa

$250.00

50ug + 250 loyalty points
Fc Ala2–Thr323
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Galectin-9(LGALS9)

Galectin-9(LGALS9)

Product name Galectin-9(LGALS9)
Uniprot ID O00182-2
Uniprot link https://www.uniprot.org/uniprot/O00182
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYI SFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAV DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight 61.76kDa
Protein delivered with Tag? N-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Thr323
Protein Accession O00182
Spec:Entrez GeneID 3965
Spec:NCBI Gene Aliases HUAT; LGALS9A
Spec:SwissProtID Q3B8N1
NCBI Reference O00182
Aliases /Synonyms LGALS9、Medium, Gal-9delta5、D5,Gal-9、Ecalectin、Tumor antigen HOM-HD-21
Reference PX-P4585
Note For research use only
Molecular Constructor
Fc Ala2–Thr323
Product name Galectin-9(LGALS9)
Uniprot ID O00182-2
Uniprot link https://www.uniprot.org/uniprot/O00182
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYI SFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAV DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight 61.76kDa
Protein delivered with Tag? N-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Thr323
Protein Accession O00182
Spec:Entrez GeneID 3965
Spec:NCBI Gene Aliases HUAT; LGALS9A
Spec:SwissProtID Q3B8N1
NCBI Reference O00182
Aliases /Synonyms LGALS9、Medium, Gal-9delta5、D5,Gal-9、Ecalectin、Tumor antigen HOM-HD-21
Reference PX-P4585
Note For research use only
Molecular Constructor
Fc Ala2–Thr323

There are no reviews yet.

Be the first to review “Galectin-9(LGALS9)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products