Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human NKG2D-CD314 recombinant protein, C-His Tag

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P26718
Molecular weight:
15.29kDa

$250.00

50ug + 250 loyalty points
Phe78–Val216 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human NKG2D-CD314 recombinant protein, C-His Tag

Product name Human NKG2D-CD314 recombinant protein, C-His Tag
Uniprot ID P26718
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Molecular weight 15.29kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe78-Val216
Aliases /Synonyms KLRK1 D12S2489E, NKG2D
Reference PX-P4902
Note For research use only
Molecular Constructor
Phe78–Val216 His
Product name Human NKG2D-CD314 recombinant protein, C-His Tag
Uniprot ID P26718
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Molecular weight 15.29kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe78-Val216
Aliases /Synonyms KLRK1 D12S2489E, NKG2D
Reference PX-P4902
Note For research use only
Molecular Constructor
Phe78–Val216 His

SDS-PAGE for Human NKG2D-CD314 recombinant protein, C-His Tag

SDS-PAGE for Human NKG2D-CD314 recombinant protein, C-His Tag

Human NKG2D-CD314 recombinant protein, C-His Tag, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human NKG2D-CD314 recombinant protein, C-His Tag

There are no reviews yet.

Be the first to review “Human NKG2D-CD314 recombinant protein, C-His Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products