Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tesnatilimab Biosimilar – Anti-KLRK1 mAb – Research Grade

  • PX-TA1724-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade

Product name Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade
Uniprot ID P26718
Source CAS 2242758-08-1
Species Humanized
Raw Antigen Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tesnatilimab,JNJ-64304500, NN8555,NNC142-0002 (HUMAN IGG4 ANTI-NKG2D MONOCLONAL ANTIBODY),KLRK1,anti-KLRK1
Reference PX-TA1724
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4,Kappa
Clonality Monoclonal Antibody
Product name Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade
Uniprot ID P26718
Source CAS 2242758-08-1
Species Humanized
Raw Antigen Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tesnatilimab,JNJ-64304500, NN8555,NNC142-0002 (HUMAN IGG4 ANTI-NKG2D MONOCLONAL ANTIBODY),KLRK1,anti-KLRK1
Reference PX-TA1724
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4,Kappa
Clonality Monoclonal Antibody
Product name PX-TA1724-50
Uniprot ID P26718
Source CAS 2242758-08-1
Species Humanized
Raw Antigen Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tesnatilimab,JNJ-64304500, NN8555,NNC142-0002 (HUMAN IGG4 ANTI-NKG2D MONOCLONAL ANTIBODY),KLRK1,anti-KLRK1
Reference PX-TA1724
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Tesnatilimab Biosimilar, also known as Anti-KLRK1 mAb, is a monoclonal antibody that has been developed as a potential therapeutic for various diseases. This biosimilar is a research grade version of Tesnatilimab, which is a fully humanized monoclonal antibody targeting the KLRK1 protein. In this article, we will discuss the structure, activity, and potential applications of Tesnatilimab Biosimilar.

Structure of Tesnatilimab Biosimilar

Tesnatilimab Biosimilar is a fully humanized monoclonal antibody that has been developed using advanced recombinant DNA technology. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab regions are responsible for binding to the target protein, while the Fc region is involved in immune effector functions.

Activity of Tesnatilimab Biosimilar

The main target of Tesnatilimab Biosimilar is the KLRK1 protein, also known as NKG2D. This protein is a receptor found on the surface of natural killer (NK) cells, γδ T cells, and some CD8+ T cells. KLRK1 plays a crucial role in the immune response by recognizing and binding to stress-induced ligands on the surface of infected or transformed cells. This binding leads to the activation of the immune cells and the elimination of the target cells.

Tesnatilimab Biosimilar works by binding to the KLRK1 protein, thereby blocking its interaction with the stress-induced ligands. This prevents the activation of the immune cells and ultimately leads to the inhibition of cell killing. This activity of Tesnatilimab Biosimilar has potential therapeutic applications in various diseases, as discussed below.

Therapeutic Applications of Tesnatilimab Biosimilar

1.

Cancer:

One of the main therapeutic applications of Tesnatilimab Biosimilar is in the treatment of cancer. KLRK1 is overexpressed on the surface of many cancer cells, and its interaction with the stress-induced ligands promotes tumor growth and metastasis. By blocking this interaction, Tesnatilimab Biosimilar can inhibit tumor growth and enhance the immune response against cancer cells. This makes it a potential treatment option for various types of cancer, including lung, breast, and colon cancer.

2. Autoimmune diseases:

KLRK1 has also been implicated in the development of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. In these conditions, the immune system mistakenly attacks healthy cells in the body. Tesnatilimab Biosimilar can potentially regulate the immune response by inhibiting the activation of immune cells, thus providing a potential treatment option for autoimmune diseases.

3.

Infectious diseases:

Infectious diseases, such as viral and bacterial infections, also involve the activation of immune cells through the KLRK1 protein. Tesnatilimab Biosimilar can potentially block this activation and enhance the immune response against these pathogens. This makes it a potential therapeutic option for infectious diseases, including influenza and HIV.

Conclusion

In summary, Tesnatilimab Biosimilar is a fully humanized monoclonal antibody targeting the KLRK1 protein. Its structure, activity, and potential therapeutic applications make it a promising candidate for the treatment of various diseases. Further research and clinical trials are needed to fully understand the potential of this biosimilar and its role in improving human health.

SEC-HPLC of Tesnatilimab Biosimilar - Anti-CD314;KLRK1 mAb - Research Grade

SEC-HPLC of Tesnatilimab Biosimilar - Anti-CD314;KLRK1 mAb - Research Grade

Tesnatilimab Biosimilar - Anti-CD314;KLRK1 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tesnatilimab Biosimilar – Anti-KLRK1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products