Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD58 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P19256
Molecular weight:
40kDa

Original price was: $302.00.Current price is: $265.00.

50ug 12% OFF + 265 loyalty points
Met1~Arg215 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD58 Recombinant Protein

Product name PX-P4086-100
Uniprot ID P19256
Uniprot link http://www.uniprot.org/uniprot/P19256
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight 40kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg215
Protein Accession P19256
Spec:Entrez GeneID 965
Spec:NCBI Gene Aliases ag3; LFA3; LFA-3
Spec:SwissProtID Q5U053
NCBI Reference P19256
Aliases /Synonyms LFA3, Ag3
Reference PX-P4086
Note For research use only
Molecular Constructor
Met1~Arg215 His
Product name PX-P4086-1MG
Uniprot ID P19256
Uniprot link http://www.uniprot.org/uniprot/P19256
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight 40kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg215
Protein Accession P19256
Spec:Entrez GeneID 965
Spec:NCBI Gene Aliases ag3; LFA3; LFA-3
Spec:SwissProtID Q5U053
NCBI Reference P19256
Aliases /Synonyms LFA3, Ag3
Reference PX-P4086
Note For research use only
Molecular Constructor
Met1~Arg215 His
Product name PX-P4086-50
Uniprot ID P19256
Uniprot link http://www.uniprot.org/uniprot/P19256
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight 40kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg215
Protein Accession P19256
Spec:Entrez GeneID 965
Spec:NCBI Gene Aliases ag3; LFA3; LFA-3
Spec:SwissProtID Q5U053
NCBI Reference P19256
Aliases /Synonyms LFA3, Ag3
Reference PX-P4086
Note For research use only
Molecular Constructor
Met1~Arg215 His

SDS-PAGE for CD58 Recombinant Protein

SDS-PAGE for CD58 Recombinant Protein

CD58 Recombinant Protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

CD58 Recombinant Protein

There are no reviews yet.

Be the first to review “CD58 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products