Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fianlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade

  • PX-TA1588-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fianlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

Product name Fianlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 2126132-98-5
Species Homo sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fianlimab ,REGN3767,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1588
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Fianlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 2126132-98-5
Species Homo sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fianlimab ,REGN3767,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1588
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1588-50
Uniprot ID P18627
Source CAS 2126132-98-5
Species Homo sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fianlimab ,REGN3767,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1588
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Fianlimab Biosimilar is an anti-LAG3, CD223 monoclonal antibody (mAb) that has been developed as a research grade therapeutic agent. It is a biosimilar version of the FDA-approved drug, Fianlimab, which is used to treat certain types of cancer. In this article, we will provide a scientific description of Fianlimab Biosimilar, including its structure, activity, and potential applications as an antibody and therapeutic target.

Structure

Fianlimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is composed of two identical heavy chains and two identical light chains. The heavy chains are approximately 50 kDa in size and consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains are approximately 25 kDa in size and consist of two constant domains (CL and CL2) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the target antigen, LAG3.

Activity

Fianlimab Biosimilar works by binding to LAG3, which is a cell surface protein that is expressed on certain immune cells, including T cells, B cells, and natural killer cells. LAG3 is known to play a role in regulating immune responses, and its overexpression has been linked to various diseases, including cancer. By binding to LAG3, Fianlimab Biosimilar blocks its activity and prevents it from inhibiting the immune response. This allows for a more robust and effective immune response against cancer cells.

Additionally, Fianlimab Biosimilar has been shown to have an antibody-dependent cell-mediated cytotoxicity (ADCC) effect, where it can bind to cancer cells and activate immune cells to attack and kill them. This dual mechanism of action makes Fianlimab Biosimilar a potent and promising therapeutic agent for cancer treatment.

Applications as an Antibody

As an antibody, Fianlimab Biosimilar has a wide range of potential applications in both research and clinical settings. It can be used as a tool in various research studies to investigate the role of LAG3 in immune regulation and its potential as a therapeutic target. Fianlimab Biosimilar can also be used in diagnostic assays to detect the expression of LAG3 in different types of cancer and monitor its levels during treatment.

Therapeutic Target

As a therapeutic target, Fianlimab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. It has been shown to have a favorable safety profile and can be used in combination with other cancer therapies to enhance their efficacy. Fianlimab Biosimilar is currently being evaluated in several ongoing clinical trials, and it is expected to receive FDA approval in the near future.

Conclusion

In summary, Fianlimab Biosimilar is a research grade anti-LAG3, CD223 monoclonal antibody that has a complex structure and a dual mechanism of action. It has the potential to be used as an antibody in research studies and diagnostic assays, as well as a therapeutic target for the treatment of various types of cancer. With its promising results in clinical trials, Fianlimab Biosimilar is expected to be a valuable addition to the current arsenal of cancer therapies.

SDS-PAGE for Fianlimab Biosimilar - Anti-CD223;LAG3 mAb - Research Grade

SDS-PAGE for Fianlimab Biosimilar - Anti-CD223;LAG3 mAb - Research Grade

Fianlimab Biosimilar - Anti-CD223;LAG3 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Fianlimab  Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

There are no reviews yet.

Be the first to review “Fianlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products