Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ieramilimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ieramilimab ELISA Kit

Ieramilimab ELISA Kit

Product name Ieramilimab ELISA Kit
Uniprot ID P18627
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX202
Note For research use only.
Sample type Plasma, Serum
Target Ieramilimab
Immunogen Ieramilimab

The Structure of Ieramilimab ELISA Kit

Ieramilimab, also known as TJC4, is a human monoclonal antibody that specifically binds to the human interleukin-6 receptor (IL-6R). This antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have one constant domain (CL) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the IL-6R.

The Ieramilimab ELISA (enzyme-linked immunosorbent assay) Kit is a diagnostic tool used to measure the levels of Ieramilimab in biological samples. The kit contains all the necessary components for the detection and quantification of Ieramilimab, including coated plates, detection antibodies, and standards. The coated plates are pre-coated with an antigen that specifically binds to Ieramilimab, while the detection antibodies are conjugated with an enzyme for colorimetric detection.

The Activity of Ieramilimab ELISA Kit

Ieramilimab ELISA Kit is a highly sensitive and specific tool for the detection of Ieramilimab in various biological samples, such as serum, plasma, and cell culture supernatant. The assay is based on the principle of sandwich ELISA, where the coated plates capture the Ieramilimab present in the sample, and the detection antibodies bind to the captured Ieramilimab. The enzyme conjugated to the detection antibodies then catalyzes a colorimetric reaction, which can be measured by a spectrophotometer. The intensity of the color is directly proportional to the amount of Ieramilimab present in the sample, allowing for accurate quantification.

The Ieramilimab ELISA Kit has a wide dynamic range, with a lower limit of detection of 0.01 ng/mL and an upper limit of 10 ng/mL. This high sensitivity and dynamic range make the kit suitable for both qualitative and quantitative analysis of Ieramilimab. Additionally, the kit has a high specificity, as it only detects Ieramilimab and does not cross-react with other molecules, ensuring accurate and reliable results.

The Application of Ieramilimab ELISA Kit

Ieramilimab ELISA Kit has a wide range of applications in both research and clinical settings. In research, the kit can be used to measure the levels of Ieramilimab in various biological samples, providing valuable insights into the pharmacokinetics and pharmacodynamics of this therapeutic antibody. It can also be used to monitor the efficacy of Ieramilimab treatment in pre-clinical and clinical studies.

In a clinical setting, the Ieramilimab ELISA Kit can be used as a diagnostic tool for various diseases associated with IL-6R, such as rheumatoid arthritis and systemic juvenile idiopathic arthritis. It can also be used to monitor the response to Ieramilimab therapy in patients with these diseases. Additionally, the kit can be used for quality control in the manufacturing process of Ieramilimab, ensuring the consistency and potency of the antibody.

In conclusion, the Ieramilimab ELISA Kit is a valuable tool for the detection and quantification of Ieramilimab in various biological samples. Its high sensitivity, specificity, and wide dynamic range make it suitable for a variety of applications in both research and clinical settings. As the use of Ieramilimab as a therapeutic antibody continues to grow, the Ieramilimab ELISA Kit will play a crucial role in its development and application.

Ieramilimab ELISA Kit

There are no reviews yet.

Be the first to review “Ieramilimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products