Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ieramilimab Biosimilar – Anti-LAG3 mAb – Research Grade

  • PX-TA1562-50
  • Validated ELISA
Isotype:
IgG4, Kappa

Original price was: $129.00.Current price is: $100.00.

50ug 22% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade

Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name PX-TA1562-50
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody

The Structure and

Activity of Ieramilimab Biosimilar: An Anti-LAG3 mAb for Research Introduction

Ieramilimab Biosimilar, also known as Anti-LAG3 mAb, is a monoclonal antibody that has been developed as a biosimilar to the FDA-approved drug, Ieramilimab. This antibody targets the Lymphocyte Activation Gene 3 (LAG3) protein, which is a promising therapeutic target for various diseases. In this article, we will discuss the structure, activity, and potential applications of Ieramilimab Biosimilar as a research-grade antibody.

Structure of Ieramilimab Biosimilar

Ieramilimab Biosimilar is a humanized IgG1 monoclonal antibody, meaning it is a recombinant antibody with a human constant region and a murine variable region. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The variable region of the antibody is responsible for binding to the LAG3 protein, while the constant region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The crystal structure of Ieramilimab Biosimilar has been determined, revealing that the antibody has a Y-shaped structure with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab regions contain the variable regions of the heavy and light chains, which form the antigen-binding site. The Fc region is responsible for interacting with immune cells and triggering effector functions.

Activity of Ieramilimab Biosimilar

Ieramilimab Biosimilar specifically targets the LAG3 protein, which is expressed on the surface of T cells, B cells, and natural killer (NK) cells. LAG3 is a negative regulator of immune responses and is involved in the suppression of T cell activation and proliferation. By binding to LAG3, Ieramilimab Biosimilar can block its inhibitory function and enhance immune responses against cancer cells and pathogens.

In addition to blocking LAG3, Ieramilimab Biosimilar also has effector functions that can directly kill target cells. The Fc region of the antibody can bind to Fc receptors on immune cells, such as natural killer cells, macrophages, and dendritic cells, leading to the destruction of target cells through ADCC and CDC mechanisms.

Potential Applications of Ieramilimab Biosimilar

Ieramilimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various cancers, including melanoma, non-small cell lung cancer, and solid tumors. As a research-grade antibody, Ieramilimab Biosimilar can also be used in laboratory experiments to study the role of LAG3 in immune responses and to develop new therapies targeting this protein.

Moreover, Ieramilimab Biosimilar can be used in combination with other

cancer therapies, such as immune checkpoint inhibitors, to enhance their efficacy. The antibody has also shown potential in treating autoimmune diseases, as LAG3 is involved in regulating immune tolerance and preventing autoimmunity.

Conclusion

Ieramilimab Biosimilar is a promising research-grade antibody that targets the LAG3 protein, a key regulator of immune responses. Its unique structure and activity make it a potential therapeutic option for various diseases, particularly cancer. With ongoing clinical trials and further research, Ieramilimab Biosimilar has the potential to improve patient outcomes and contribute to the development of novel immunotherapies.

Ieramilimab Biosimilar, Anti-LAG3 mAb, monoclonal antibody, LAG3, therapeutic target, research-grade antibody, structure, activity, applications, cancer, autoimmune diseases

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind to Ieramilimab Biosimilar - Anti-LAG3 mAb (cat. No.PX-TA1562) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade

SDS-PAGE for Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade

Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ieramilimab  Biosimilar - Anti-LAG3  mAb - Research Grade

There are no reviews yet.

Be the first to review “Ieramilimab Biosimilar – Anti-LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products